(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE633

CP002031.PE633       Location/Qualifiers
FT   CDS_pept        680995..681939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0643"
FT                   /product="membrane protein DUF2232, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83506"
FT                   /protein_id="ADI83506.1"
FT                   /translation="MENSLRSTLLDIVKGCIATVALFIAYLELPVIGMLAGVVVPLPAL
FT                   LYDLKRGKWSGLAIVLASALIFMLIAGPAGALLYVLQAGIFSLALPRFLTMGGGPARAL
FT                   ASAVAVTVAVITAAAVGYGVTRGVTVEGQVAESLQSSITQAIQLYEKSGVSGADLDELR
FT                   EGMEQAAKSLAQLYPSLFVVGIAMAGGLNLLLLQRFGRRLGLAVPGGSFGKYRNPDHLV
FT                   WLPICAGFALLAGHDAVTTIALNVLVLTGFLYFIQGMAIIIHLFDRYAAPAFLRYLLYF
FT                   LLFVQAYLVVAVALFGLLDLWGNFRRPRIPTNL"
     atggagaaca gtctcaggag caccctgctc gatatcgtca aagggtgcat cgcaacggtg        60
     gcgctcttca tcgcctacct ggaacttccg gttatcggca tgcttgcggg ggtggtagta       120
     ccgctccccg ccctgctcta tgatctcaag cggggcaaat ggtccgggct ggctattgtg       180
     ctggcctcag cgctcatatt catgctgatt gccggccccg caggagccct cctgtacgtg       240
     ttgcaggcgg gcattttctc cctggcattg ccgcggttcc tcacaatggg cgggggccct       300
     gcacgggctc tcgcatcagc cgtggccgtg acggtggcag tcattaccgc cgcagcggtc       360
     ggctatgggg taacccgtgg cgtcaccgtc gaggggcaag tcgccgagtc gctgcaatcc       420
     agcataaccc aggcgattca actttatgaa aagagtgggg taagcggtgc cgatctcgac       480
     gaactgcgcg agggtatgga gcaggcagcc aaatcgcttg ctcagctcta tccgtcactc       540
     tttgtcgtgg ggattgccat ggccggcggg ctgaacctgc ttctgctcca gcggttcgga       600
     cgccggttgg gccttgcggt tcccgggggc tccttcggga aataccggaa ccccgatcat       660
     ctggtctggc tgccgatttg cgcgggattt gccctgctgg ccggccacga cgcagtgacg       720
     actattgccc tgaacgtact ggtcctgacc gggtttctct atttcattca aggcatggcg       780
     atcatcattc atctgttcga ccgttatgcc gcaccggcat ttctgaggta tctgttgtat       840
     ttcctgctct ttgtgcaggc ctatctggtc gtagcggtgg cgttgttcgg actgttggat       900
     ctctggggca acttccgcag accgcgaatc ccaacaaacc tgtaa                       945
//

If you have problems or comments...

PBIL Back to PBIL home page