(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE638

CP002031.PE638       Location/Qualifiers
FT   CDS_pept        685646..686389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0648"
FT                   /product="protein of unknown function DUF3108"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83511"
FT                   /protein_id="ADI83511.1"
FT                   /translation="MRIYAVLAAAVVVLWGNSTVGAAPKVPEKLVYELSWTGVPVGTAT
FT                   QEISDAGDLRTIVSTARSNDWLSVFFPVEDRIVSSYDRHRAPFPGLARHYRLQTREGNR
FT                   RRDREIVFEHERGVARFTDHKTGEKANIPIPVDTIDVYGSFYYVRYLPLEVGTSHHLNI
FT                   LDSKRQRLIEVRVLRKEKLKTVLGEVETIVIQPLVYSEGVFEGKGTVHIWLTDDERRIP
FT                   VRARTRVTVGSVTATLVDGTFEKKR"
     atgaggatct atgccgttct tgccgcggca gtcgtagtgc tgtgggggaa ctcgacggtc        60
     ggggcagcgc cgaaggttcc cgaaaagctc gtgtacgagt tgtcgtggac cggcgttccg       120
     gtcggtacgg ccacccagga gatttcggat gcgggcgatc tccgcacgat cgtttcaact       180
     gcccggtcca acgactggct atcggtcttt tttcccgtgg aggaccgaat cgtgagcagc       240
     tacgaccggc atcgggcgcc cttcccgggt ctggcccgcc actaccggct ccagacccgg       300
     gaaggaaacc ggcggcggga ccgggagatc gtgttcgaac atgagcgtgg agtggcccgg       360
     tttaccgatc acaaaaccgg ggaaaaggcg aatatcccta ttccggtcga taccatcgat       420
     gtgtacggca gtttttacta cgtgcgctac ctccccctgg aggtgggaac gtcccaccac       480
     ctgaacatcc tggacagcaa gcgccagcgg ctcatcgagg tgcgggttct gcgcaaggaa       540
     aagctcaaaa cagtgctggg tgaagtggag accatcgtca tccagccgct ggtctattcg       600
     gagggggtgt tcgagggaaa ggggacggtg catatctggc tcaccgatga tgagcggcgc       660
     attccggtgc gggcgcgaac cagggtcacg gtggggagcg tgacagcaac gctggtggac       720
     gggaccttcg agaaaaagcg gtag                                              744
//

If you have problems or comments...

PBIL Back to PBIL home page