(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE642

CP002031.PE642       Location/Qualifiers
FT   CDS_pept        689195..690358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0651"
FT                   /product="ABC transporter, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0651"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83514"
FT                   /protein_id="ADI83514.1"
FT                   /translation="MNITKLVVKNITRRRGRFVFTLLGITIGIASFVAFLALGGGLKDE
FT                   VRREAAALGANLVVTPNGSCAYEQVSILTGEQLPSTITMEEVGRVAAIQGLTAVPVLTE
FT                   KTAIRNRPVGVAGVLPDAMKPFKGWEVRSGEYFANNDERVVVVGAAAAESFGLKPGDEV
FT                   TIRGTRLPVKGVLKETGSKDDTTLFLALSVAQELFKAAGKASFVAVKVDDLSRTDDYIM
FT                   KIKETVNAGVVSDKQMLKSVLGIIGTVNVTLQLIAAISVLAAAFGIVNTMMTATYERRR
FT                   EIGILQAIGARRREIFAIFLMESGFYGLLGGICGVAGGLAASILVGPMVNQNAFLAFVK
FT                   GNDPAAVLDPKLMVGSVAFSVAVALVAGLYPAWRAARLTPVEAISHE"
     atgaacatca cgaaactggt ggttaagaac atcacccgcc ggcgggggag gttcgtgttc        60
     acccttctgg gcatcaccat cggcatcgcc tcctttgtgg catttctggc cctggggggc       120
     gggctcaagg atgaggtgcg gcgcgaggcg gccgccctgg gggcgaacct ggtggtgacc       180
     cccaatgggt cgtgcgccta tgagcaggta tcgattctca ccggcgagca gcttccctca       240
     accatcacca tggaggaggt gggccgggtc gcggccatcc aggggctcac ggcggtgccg       300
     gtcctgaccg agaagaccgc catccggaac cgtcccgtgg gggtggccgg cgttcttccc       360
     gacgccatga agccgttcaa ggggtgggag gtgcgcagcg gagagtattt cgcgaataat       420
     gacgagcggg tcgtggtggt cggcgcggcc gcggctgaat ccttcggcct caagcccggc       480
     gacgaggtta ccatccgcgg gacgcggctg ccggtgaagg gggtgttgaa ggagaccggc       540
     agcaaggacg acaccaccct gttcctggcc ctctccgtgg cccaggagct cttcaaggcc       600
     gccggcaagg cgtcgttcgt ggcggtgaag gtggacgacc tctcccggac cgacgactac       660
     atcatgaaga tcaaggaaac ggtgaacgcg ggggtcgtgt cggacaagca gatgctcaag       720
     tcggtcctgg gcatcatcgg cacggtgaat gtgacgcttc agttgatcgc cgcgatatcg       780
     gtgctggccg cggccttcgg catcgtcaat accatgatga ccgccaccta cgagcggcgt       840
     cgtgagatcg gcatcctcca ggccatcggg gcgcgacgca gggaaatatt cgccattttt       900
     ctcatggagt ccggattcta cggcctcctg ggcggcatct gcggcgtcgc gggaggcctg       960
     gcggcgtcga tcctggtcgg gcccatggta aatcagaatg ccttcctggc cttcgtgaag      1020
     ggcaatgacc ctgcggcggt cctggacccg aagctcatgg tcggctcagt ggccttctcg      1080
     gtggcggttg ccctggtggc cgggctctat cccgcgtggc gcgccgcgcg gctcacccca      1140
     gtggaggcga tcagccatga gtga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page