(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE645

CP002031.PE645       Location/Qualifiers
FT   CDS_pept        691865..695428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0654"
FT                   /product="DUF748 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0654"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83517"
FT                   /protein_id="ADI83517.1"
FT                   /translation="MKRWHKAAIGAGACIILLVGFIGLILPGIVKTRAMEGVEAATGRK
FT                   LVVGDISINPFTWTVEVRDVSFTEPDKTTVFASFSSARVQVSPASIFRMAPVVREARLS
FT                   SPHVRLVRVGPNTYNFSDLLGKKKAEPKKDEGLPRFSLNNITIANGSLDFLDQGERIMR
FT                   RHEVRRLDLGIPFLSTIPYFADRYITPRFSALVNDAPVRAEGKLRPFAKAAEYDLNVDL
FT                   RDLAIKRFASYIPADLPILVQDGTLSTTLGITYRVAEGKDPDLMVSGSARLAGVKVAEH
FT                   GGVPLLALAGLEARLNRARVLAGEFPLSLVTLERPEIHLARDAAGIWNLQRLAGKKTAA
FT                   PAAEEKPASPGRKPLVSVAEFRLADGAVQLDDRLPAGGFAARVEKIAMTVKGFSTAPGT
FT                   AADCMLSLATGRGEEARVEGRVTPDPLALTGTVQVAGIDLGAYYPYLSPYLTAPVTGKL
FT                   DAGADIGFSTPDGVRVDKGRIRLASLRVPFEGKDEARLAEVAGEDIAFVQKDANLTVGA
FT                   VRLRDGEIRFSRNGKGEWSPLTLVRPPGSAPAKQPARSREKAAAPFSYRIGTVSLSGLT
FT                   ASFTDGTIEDRPTFTLRRIAAGAENLTGPKFGQIPFRFAARYGKEGELKATGRVRPEPL
FT                   TVNGNVTIRQLPLTDFDYYLPKNLLAILADGTLDTTMAVSLARSGGKLTGSFAGGLGVR
FT                   SFYLLDGDGEDLLRWESLQLDKVKGNIDPFTLDIREVALNQFYSKIVIDPDGRLNLQKL
FT                   FAPAPEPAEGAAKPEAVAAVAQPAPPPELPARQRAITIGAVTMQAGTLDFSDRHMPKPY
FT                   ATTFYNLGGRVSGLTSEESKFADVDLRGNLENHSPISITGRINPLRDDLYADIKVRFTD
FT                   IELSPMTPYSGTYLGYAVDKGKLFLDLQYTIENKQLNSENKVFIDQLTFGNRIESDKAT
FT                   SLPVRLAVALLKDRKGEIHLDLPVTGRTDDPQFSVWRVVLQILKNLLVKAATSPFALLQ
FT                   SAFGGGADLSVISFGYGSAELAPAEQDKLRKIAQALADRPAIKVEVAGYVERDKDAEGY
FT                   RSELLRRKVRAEKFLEMVKKKQNKPGDSAETVVVAPEEYERLLTAVYKKEKFPKPRTII
FT                   GTVKELPVEEMTKLILANTVVGDAELKTLADERSAAVRTFLVEQGKLDSARVFQKSGDI
FT                   FKRPDKQGERGARVEFGAAVD"
     atgaaacggt ggcacaaggc ggcaatcggc gcaggcgcat gtatcatcct tctggtcggc        60
     ttcatcggcc tcatcctgcc tggaatcgtg aaaacacggg ccatggaggg agtagaggcg       120
     gccaccggcc ggaaactcgt tgtgggtgat atttccatca acccgttcac ctggacggtg       180
     gaggtgcgcg atgtcagctt caccgagccc gacaagacca cggtcttcgc ctctttcagc       240
     agcgcacggg tccaggtgag ccccgcctcc attttccgga tggctcccgt ggtccgcgag       300
     gcccggcttt cgtcccccca tgtccggctc gtgcgcgtgg gacccaatac ctacaacttt       360
     tccgacctgc tcgggaaaaa gaaggccgag cccaagaaag acgaggggtt gccccgtttt       420
     tccctcaaca atatcaccat cgccaacggt tccctggact tcctggacca gggggagcgg       480
     atcatgcggc gccacgaagt gcggcggctc gatttgggca ttccgtttct cagcactatc       540
     ccctactttg ccgaccgcta cataaccccc cgcttcagcg ccctggtcaa tgatgccccg       600
     gtgcgggccg aggggaagct gcgccccttt gccaaggcgg ccgagtatga tctcaatgtg       660
     gacctgcgcg acctggccat caagcgcttt gcatcctata tcccggccga tctgccgatt       720
     ctggtgcagg acggaaccct gtccaccact ctcggcatca cctaccgggt tgccgaggga       780
     aaagatccgg acctgatggt ttccggctcg gcgcggttgg ccggggtcaa ggtcgccgag       840
     cacggtggcg tgccgctctt ggcgctggct gggctggaag cccgcctgaa ccgtgcccgg       900
     gtgctggccg gggagtttcc cctttcgctg gtgaccctgg agcgtcccga gatccatctg       960
     gcgcgggacg cagcggggat ctggaacctg cagcgcctgg ccgggaaaaa aactgccgct      1020
     ccggcagcag aggagaaacc cgcatcgccg ggccgcaagc cgctcgtgtc cgtggccgag      1080
     ttccgcctgg cggacggtgc ggtgcagctg gatgaccgcc ttcccgccgg cggttttgcc      1140
     gcccgggtgg aaaagatcgc catgaccgtc aaagggtttt ccactgcgcc gggcacggct      1200
     gccgactgca tgctctccct cgccaccggc cggggtgaag aggcgcgggt ggaggggcgc      1260
     gtgacccccg atccactggc gctgaccggc accgtccagg tggccggcat cgacctgggg      1320
     gcctactatc cctatctgag cccctatctg acggccccgg tgacgggtaa gctcgacgcg      1380
     ggcgcagata tcggcttcag cacgcccgac ggggttcggg tggacaaggg gcgcatccgc      1440
     ctcgcctcgc tcagggtgcc tttcgaggga aaggatgagg cccgcctggc cgaggtggcc      1500
     ggggaggata tcgcgttcgt gcagaaggac gccaatctga cggtgggcgc tgttcggctg      1560
     cgtgacggag agattcggtt ctcccgcaac gggaagggag agtggtctcc cctcacgctg      1620
     gtgcggccgc ccggatcggc accggcgaaa cagcccgccc ggtccaggga aaaggcagcc      1680
     gctccgttca gctaccgcat cggcacggta agtctatcgg gcctcaccgc ctcgttcact      1740
     gatggcacca tcgaggatcg tcccaccttt accctgcgga ggatcgcggc gggagcggag      1800
     aatctcaccg gtccgaaatt cggccagata cccttccgct ttgccgcccg ttacggcaag      1860
     gagggtgagc tcaaggcaac gggcagggtc cggcccgagc cgctcaccgt caacggcaac      1920
     gtgaccatca ggcagcttcc cctgactgat ttcgattact atctgccaaa gaatctgctc      1980
     gccatcctgg ccgacggcac cctcgacacc accatggccg tcagccttgc ccgcagcggc      2040
     gggaagctga ccgggagctt cgccggcggg ctgggggtcc gttccttcta cctgctggac      2100
     ggtgacggcg aagacctgct ccgctgggaa agcctccagc tcgacaaggt caaggggaac      2160
     atcgacccct tcaccctcga catccgcgaa gttgctctca accagtttta ctccaagatc      2220
     gtcatcgacc cggatggccg cctcaacctc cagaagctct tcgcccccgc gccggaaccg      2280
     gcggaggggg cggcaaaacc ggaagcggtc gcggcagtgg cgcaaccggc tccgcctccg      2340
     gagctgccgg cccggcagcg ggccatcacc atcggtgcgg tcaccatgca ggcggggacc      2400
     ctcgacttca gcgacaggca catgccgaaa ccctatgcca ccaccttcta caatcttggc      2460
     ggccgggtga gcggcctcac gtcggaggag agcaaatttg ccgacgtgga cctgcggggg      2520
     aatctggaga accactcccc gatcagcatc accggcagga tcaaccccct gcgcgacgat      2580
     ctctacgccg acatcaaggt gcggttcact gatatcgaac tctcgcccat gaccccttac      2640
     tccggcacct acctggggta tgccgtggac aaggggaaac tcttcctgga cctccagtac      2700
     acgatcgaga acaagcaact caattcagag aacaaggtct tcatcgacca gcttaccttc      2760
     ggcaaccgga tcgagagcga caaggccacg agcctgccgg tgcgtctggc cgtggcactg      2820
     ctgaaggatc gcaagggtga gatccatctg gacctgccgg tcaccggccg tacggatgat      2880
     ccccagttca gcgtctggcg ggtggtgctc cagatcctga aaaacctgct ggtgaaggcg      2940
     gccacatctc cctttgcact cctgcagtcc gccttcggcg gcggcgccga cctgagcgtc      3000
     atctccttcg gctacggctc ggcggagctt gccccggcgg agcaggacaa actccgaaaa      3060
     atcgcccagg ccctggccga tcgccccgcc atcaaggtgg aggtggccgg ctacgtggag      3120
     cgggacaagg acgccgaggg ataccggtcc gagctgctga ggcggaaggt gcgggcggag      3180
     aagttcctgg agatggtgaa gaaaaagcag aacaagccgg gcgattcggc cgagacggtg      3240
     gtcgtggctc cggaggagta cgagcggttg ctcacggcag tctacaagaa ggagaagttc      3300
     cccaagccgc gcaccatcat cggtacggtg aaggaactcc ccgttgagga gatgaccaag      3360
     ctgatcctgg ccaatacggt cgtgggcgac gccgagctca agaccctggc cgacgagcgg      3420
     tccgcagcgg tccgcacctt cctggtggag cagggcaagc tcgattcggc ccgggtcttc      3480
     cagaagagcg gcgatatctt caaacgccca gataagcagg gcgaacgcgg cgcccgggtt      3540
     gaattcggcg cagccgttga ctga                                             3564
//

If you have problems or comments...

PBIL Back to PBIL home page