(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE657

CP002031.PE657       Location/Qualifiers
FT   CDS_pept        complement(710300..711214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0667"
FT                   /product="carbohydrate kinase, PfkB family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0667"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83530"
FT                   /protein_id="ADI83530.1"
FT                   /translation="MVVTGLGQCCWDTLAEVEEYPSPDSKAESGQWVEQGGGPAATALV
FT                   TVARLGLQCRFAGVVGDDAAGALIRHALHAEGIDVTHLLTRPGAASQRAFIMVERTGGR
FT                   RTIVWQRPTGAHLAPAELEEPFWSGSAFLHLDGLMEEASLHGVREARRRGIPVMVDAGR
FT                   MRPGMRELAKLCDYLVAAEQFFLDLGWDGSEEQFARLADGLGAPTVTVTLGDRGSLTRH
FT                   DGTTCHVPAFPVTTLDTTGAGDVFHGGYLFGLLKGWPLRETVIFASAAAALSCLHLGAQ
FT                   RGAPRLDEVIRFLVDRGIPVPAV"
     atggttgtga cgggactggg acagtgctgc tgggacacgc tggctgaggt ggaggagtat        60
     ccctcgcccg acagcaaagc agaatcggga caatgggtgg agcagggagg agggccggcg       120
     gccacggcac tggtgactgt ggcgagactc ggcctgcagt gccgctttgc cggtgtggtg       180
     ggggacgatg ccgcgggcgc gctgatccgc catgcgctcc acgcggaagg aattgacgtg       240
     acccatctgc tcacccggcc gggagccgcc tcccagcggg ccttcatcat ggtcgaacgg       300
     accggcgggc ggcggaccat cgtctggcag cgccccaccg gcgcccacct ggcccctgcg       360
     gaacttgagg agccgttctg gtccggcagc gccttcctcc acctggacgg gctcatggaa       420
     gaggcgtccc tccatggggt ccgggaggcc cggcgccggg gaatcccggt catggtggac       480
     gcgggccgga tgcgtcctgg gatgcgggag ctcgcgaaac tctgcgatta cctggtggcg       540
     gcggagcagt tcttcctcga cttgggctgg gacggttccg aggagcagtt cgcacggctt       600
     gccgacggcc tcggcgcacc gacagtcacc gttaccttgg gcgacagggg gagcctcacc       660
     cggcacgacg gaacgacctg ccacgtgccg gcgtttcccg taacgaccct ggacaccacg       720
     ggtgccgggg atgtctttca cgggggctat ctgttcgggc tcctcaaggg gtggccgttg       780
     cgggagacgg tgatcttcgc ctcggccgcg gcggcccttt catgccttca cctgggtgcc       840
     cagcggggag cgccccggct ggacgaagtg atccggttcc tcgttgaccg gggaattccc       900
     gtgccggccg tctga                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page