(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE660

CP002031.PE660       Location/Qualifiers
FT   CDS_pept        complement(713795..714514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0670"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83533"
FT                   /protein_id="ADI83533.1"
FT                   /translation="MRHYLRIITAALAGHLLAAAGAAHGWHDETHLAVARAAGYHKWYN
FT                   AAGPDIAKQKAGNIEQRNHYCNNNRGEAVTVGTVLGQIARYNDPSDEEGHLYGAIIAAL
FT                   RGYERSSREGKYAEYHLAYAAHYLADLSMPLHNTPYDDFNRRRHERNDGIVEKSVLRDV
FT                   ERIQRLMAPVALGRESFEADLAREITRIANGASRLAERMRRENRDMTPEEAYGQLAQSA
FT                   ALLEAVLGRVQQQGGER"
     atgaggcatt atcttcgcat catcaccgcg gcgcttgccg ggcatctgct cgccgcagcg        60
     ggcgctgccc atggctggca cgatgaaacc cacctggcgg ttgcacgggc ggccggctac       120
     cacaagtggt acaacgcggc aggaccggat atcgccaagc agaaggcggg aaacatcgaa       180
     cagcgcaacc actactgcaa caacaaccgg ggcgaggcgg tgaccgtcgg gacggtcctc       240
     ggccagattg cccgctacaa cgatccatcc gatgaagagg gccatctcta cggcgccatc       300
     atcgccgcgc tccggggata cgaacgctcc agccgcgagg ggaagtacgc cgaataccac       360
     ctggcctacg ctgcccacta cctggcggat ctttccatgc ccctgcacaa caccccctac       420
     gacgacttca accggaggcg ccacgaacga aacgacggca tcgtggagaa atcggttctc       480
     cgtgacgttg agcgtatcca gcggctcatg gcgccggtgg ccctgggcag agagagtttc       540
     gaagcggacc tggcccggga gatcacgcga atcgccaatg gcgccagccg gctggccgag       600
     cggatgcggc gggaaaaccg ggacatgacc ccggaggagg cctacgggca gctcgcccag       660
     agtgctgcac tgctggaagc tgttctcggc cgggttcaac agcagggggg cgaacgatga       720
//

If you have problems or comments...

PBIL Back to PBIL home page