(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE670

CP002031.PE670       Location/Qualifiers
FT   CDS_pept        731571..732401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0682"
FT                   /product="ResC/HemX-like cytochrome c biogenesis membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0682"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83545"
FT                   /protein_id="ADI83545.2"
FT                   /translation="MTDQASVYVTMNWLAVCCYVVATVFNASGIIFRKAVVEQRSYWPL
FT                   WLGLAVHSVSLIYWWRVVGHGPYMAPSEVLLSDAWIAMVLFLGFQRVFPRIRPASLVVL
FT                   PLVFLMVALANFYNPGIRSLPPTFSSIWLVLHISFYKIALGALIIALAFSIFYLLKARP
FT                   TPPDWLRRLPDLEDLDLHAYRFAGFGFIFWAIGMLAGSIWAYKSWGRYWGWDPVETWSL
FT                   ITWLIFGTYLHLRRFFRMGGRAAAWFFIFGFIVALVALFASSHMGTSIHSEYFQ"
     atgactgatc aggcatcggt atacgtgaca atgaactggc tggcagtctg ctgctatgtc        60
     gtggcgaccg tcttcaatgc cagcgggatc atcttccgga aagccgtggt ggaacaacgc       120
     agctactggc ccttgtggct ggggctggcc gtacactcgg tctctctgat ctactggtgg       180
     cgggttgtcg gtcacggtcc ctacatggcc cccagcgaag tgctgctgtc ggacgcatgg       240
     atcgccatgg tgctgttcct tggtttccag cgggtattcc cgcgcatccg gccggccagc       300
     cttgttgttc tgccgctggt gttcctgatg gtggcgctgg ccaacttcta caaccccggc       360
     atccgctcgc tgccgcccac cttcagcagc atctggctcg tgctgcacat ctcgttctac       420
     aagatcgccc tcggcgccct gatcatcgcc ctggcatttt ccatattcta cctgctgaag       480
     gcccggccga cccccccgga ctggctcagg cgcctgcctg acctggaaga tctcgacctc       540
     cacgcctacc gctttgccgg gttcggcttc atcttctggg cgatcggtat gctggccggc       600
     tccatctggg cttacaaatc atgggggcgg tactgggggt gggatccggt agagacgtgg       660
     tccctcatca cctggctgat attcgggacc tatctgcacc tgcggcgttt tttccgtatg       720
     ggggggcggg cggccgcctg gttcttcatc ttcggcttta tcgtggccct tgtcgccctg       780
     tttgcgtcgt cccacatggg gacctccatc cactcggagt atttccagta g                831
//

If you have problems or comments...

PBIL Back to PBIL home page