(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE674

CP002031.PE674       Location/Qualifiers
FT   CDS_pept        complement(734729..737908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0686"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0686"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83549"
FT                   /protein_id="ADI83549.1"
FT                   /translation="MDKPETAPLAPFPPGATYEPSLDRLMRLAAWAGAIRGDGTPVNFT
FT                   SILVGAILVEDETGAWFTRYARETGERAEAIADLVQTSEAMRPRVEEQAAAGTLPEARE
FT                   FYSSSVRDILGSALRLATRDGAEPRPLGTRHLLAALAFRLSDYHRRQLIGWGVGIAAWQ
FT                   RSTLDFLQRAFPSEDSTWVSLALEQAEAPPTEPPPAGTIFKSFAAEAPVPPVSAGPDIL
FT                   IARFTADDPTSATDLMDVRQEARAFARLAAGRAIRPPLSIGVFGEWGSGKTFFMKLMHE
FT                   HVARISRDADSEGPFHGNIVQIRFNAWHYVESNLWASLVDYIFTELDRWLKERPENPNE
FT                   TVDLLFDHLSTSRTLRLEAMDELVLRRRQRQEAEENLKTVRARFETALARQAVATAGEF
FT                   WTAVGTTMGKDRETRETIDRAGRALGVPELSASARQLSEVLQETATQAGRARTLGRSAV
FT                   AMLGRPRWLAALALILVAAPVAVVWFRDILGRTEVLSWLKEVNAAVLGLSSVMASVAGF
FT                   AGTALKRTATALDTLEGFRATLETAIAERTEEFRKNSNEAALLTDAEREAARLRSDVEQ
FT                   AERRLADADRRAADAARDFQGATARGRLNAFIRDKVVSGDYAKHLGIIATIRKDFGQLA
FT                   QLMADVDRDRELAEEYERARLDYARRVEELIARSGDVLTDEEIAALRASTTFDAESLRL
FT                   FERIILYIDDLDRCPPEKVVEVLQAIHLLLCFPLFVVVVAVDARWVSRSLKEVYPELLA
FT                   ETVIIPGTGATAPARPGAPAGEARHDATDRRTAPNNSDRERAASSQDYLEKIFQLPYWV
FT                   RAMDADACRTYIRGIVAAESTAHAARSAVSPEPAPSAPLSQPSIEQTAAATEATPLMGV
FT                   ESLPPEATPQPDTADGSSLEREARTMALTSHEAAFMAELAPHAGGTPRRGLRFVNVYRL
FT                   IRTSLPLHEHETLVGDKGEQTAYRALLAQLAIVTGAPGIASVYFDHLAALAADNLSENN
FT                   EKKGLVDLIAALGEDTRITAGTEAAPLLGALQALHDSVAPQGLGNDPALLATLHNTASV
FT                   ARRYSFTARPH"
     atggacaagc ccgaaaccgc ccccctggcg ccgtttcccc ccggagcgac ctacgaaccg        60
     tccctcgacc ggctcatgcg ccttgccgca tgggccggcg ccatccgggg ggacggcacg       120
     ccggtgaact tcacctccat cctcgtgggg gcaattctcg tggaggacga gaccggcgcc       180
     tggtttaccc gctacgcccg ggaaacggga gaacgggccg aggccatcgc cgacctggtg       240
     cagacatccg aggcgatgcg cccaagggtt gaggagcagg cagccgccgg cactctcccc       300
     gaggccaggg agttctactc ctcgtcggtg cgcgacatcc tcgggtcggc gctgcggctc       360
     gccacccgcg acggtgccga gccccgcccc ctggggacgc gccacctgct ggcggccctc       420
     gccttccgcc tctccgacta ccaccggcgc cagctcatcg gctggggggt cggcatcgcc       480
     gcctggcagc gcagcaccct cgacttcctc cagcgggcct tcccgtcgga ggattccacc       540
     tgggtctccc tggccctgga gcaggccgag gcgccgccca cggaacctcc ccccgccggc       600
     accatcttca agagctttgc cgccgaagcc cccgtcccgc ccgtcagtgc cggccccgac       660
     atcctcattg cccggttcac cgccgacgat cccacctcgg ccacggacct catggacgtc       720
     cggcaggagg ctcgggcctt tgcccgcctc gccgcgggtc gcgccatccg cccgcccctc       780
     tccatcgggg tattcggcga atgggggtcg ggcaagacct tcttcatgaa gctgatgcac       840
     gagcatgtgg cccggatttc ccgggacgcg gacagcgaag gccccttcca cggcaacatc       900
     gtccagatcc gcttcaatgc ctggcactac gtggaatcca acctgtgggc cagcctggtg       960
     gattacatct tcaccgaact ggaccgctgg ctcaaggagc gcccagaaaa ccccaacgag      1020
     accgttgacc ttctcttcga ccacctctcc acctcccgca ccctcaggct ggaggccatg      1080
     gacgaactgg tgctccgccg ccgccagcgc caggaggccg aagaaaacct gaaaaccgtc      1140
     cgggcccggt tcgagacggc cctggcccgc caggccgtgg caacagcagg cgaattctgg      1200
     accgccgtgg gcacgaccat gggcaaggac cgggagacgc gcgagaccat cgaccgcgcc      1260
     ggccgggccc tgggagttcc ggaactctcc gcctcggccc gccagttgag cgaagtgctc      1320
     caggaaaccg ccacccaggc cgggcgggcc cggaccctgg ggcgaagcgc cgtggccatg      1380
     ctcggccgcc cccggtggct ggcggccctg gccctgatcc tcgtggcggc gccggtcgcc      1440
     gtggtctggt tccgggacat cctgggtcgg acagaggtgc tctcctggct gaaggaggtg      1500
     aacgccgccg ttctgggact ctcctcggtc atggcctccg tggccgggtt cgcgggtacg      1560
     gccctcaagc gaaccgccac cgccctggac accctcgaag gcttccgcgc cactctggaa      1620
     acggccattg ccgagcggac cgaggaattc agaaagaaca gcaatgaagc ggccctgctc      1680
     accgatgccg agcgcgaggc ggcgcggctc aggagcgacg tggagcaggc cgagcgccgc      1740
     ctggccgatg ccgaccgccg cgccgccgac gcggcccgcg acttccaggg ggccacggcc      1800
     cgggggcggc tcaatgcctt catccgcgac aaggtcgtca gcggggacta tgccaagcac      1860
     ttgggtatca tcgccaccat ccgcaaggat ttcggccagc tggcccagct catggccgac      1920
     gtcgatcgcg accgggaact ggccgaggaa tacgagcggg cccgactcga ctatgcccgc      1980
     cgggtggagg agctcatcgc ccgctccggc gacgtgctga ccgacgagga gatcgccgct      2040
     ctccgggcct ccaccacctt cgacgccgaa tccctgcgcc tgttcgagcg gatcatcctc      2100
     tacatcgacg acttggaccg ctgcccgccc gaaaaggtcg tggaggtcct ccaggccatc      2160
     cacctgctcc tctgcttccc cctcttcgtg gtggtcgtgg ccgtggatgc ccgctgggtc      2220
     tcccgctccc tcaaagaggt ctacccggag cttctggccg aaaccgtcat catccccggg      2280
     accggcgcca cggcacccgc ccgccccggc gcccccgccg gcgaagcacg gcatgatgca      2340
     accgaccggc gcaccgctcc caacaactca gaccgggagc gggccgcctc gtcccaggat      2400
     tacctggaga agatcttcca gctcccctac tgggtgcgcg ccatggatgc cgacgcctgc      2460
     cggacctaca tcagggggat cgtggcggcc gaatcgacag cccatgccgc ccggtcagcc      2520
     gtatcgcccg aaccggctcc gtcggcgccg ttgtcccaac cgtcgattga gcagacggcc      2580
     gcagcgactg aagcaacgcc cttgatgggg gtggagtccc tgccccccga ggcgactcca      2640
     caacccgata ctgccgatgg atcgtccctc gaacgcgaag cccgcaccat ggccctaacc      2700
     tcccacgaag cagccttcat ggctgaactg gccccccacg ccggcggcac cccgcgccgg      2760
     ggactgcgtt tcgtcaacgt ctaccggctg atccgcacca gcctgccgct ccacgagcac      2820
     gagaccctgg tgggcgacaa gggggaacag accgcctacc gggccctttt ggcccagttg      2880
     gccatcgtca ccggcgcgcc gggtatcgcc tccgtctatt ttgaccacct agctgcgctg      2940
     gccgccgaca atctgtcgga aaacaacgag aaaaagggac tcgtcgacct catcgccgcc      3000
     ctgggtgagg acacccgcat caccgccgga accgaagccg cacccctcct gggcgcgctc      3060
     caggccctgc acgacagcgt cgccccccag gggctcggca acgatcccgc gctcctggcc      3120
     accctccaca acaccgcctc cgtggcccgg cgttattcct tcaccgcacg accccactga      3180
//

If you have problems or comments...

PBIL Back to PBIL home page