(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE675

CP002031.PE675       Location/Qualifiers
FT   CDS_pept        complement(737936..738322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0687"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83550"
FT                   /protein_id="ADI83550.1"
FT                   /translation="MKKQALIATVAAGILSLVAGVAPATDQERVSENVREKVRTEAKEQ
FT                   ERVYGSQLMTRKERAEYRARMRAAKTVQEREQIRKEHHERMKERARERGVTLPDEPPVP
FT                   GGGMGPAGMGAPGKGMGPGGGRNR"
     atgaagaagc aggcactcat cgcaaccgtc gcggcgggga tactctccct ggtcgccgga        60
     gtcgcgccgg caacggacca ggagcgcgtc agtgagaacg tccgggaaaa agtccggacc       120
     gaggccaagg agcaggaacg ggtctacggc agccagctca tgaccaggaa ggagcgggcc       180
     gaataccggg ccaggatgcg ggccgccaag accgtgcagg aacgggagca gatcaggaaa       240
     gagcaccacg agcggatgaa agaaagggcc agggagcggg gagtgaccct tcccgacgaa       300
     ccgccggtgc cgggcggcgg catgggcccg gccgggatgg gtgcccccgg caaggggatg       360
     gggcccggcg gcggcaggaa ccggtaa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page