(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE683

CP002031.PE683       Location/Qualifiers
FT   CDS_pept        746402..748171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0696"
FT                   /product="sensor histidine kinase response receiver, PAS
FT                   domain-containing"
FT                   /note="domains: PAS, HisKA, HATPase_c, REC"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0696"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83559"
FT                   /protein_id="ADI83559.1"
FT                   /translation="MTQSGPEDGSGNSRIGAAEMPEADTEKQQPASDAPSQELRDIRAQ
FT                   LELSLERYANLYHFAPVGYATIDAVGVIADANRTLAGMIGADCREMVGLLFSDFVHKDD
FT                   VTSFVSHLARCTGQREGVTGEFRLSGRNGISVDVQLSSMPLTPPGGRVSCRTAITDITM
FT                   IKRKERELNESREELCWAKEAAEDASRAKSEFLANMSHEIRTPINGVLGMLQLVLDTEL
FT                   GDEQRHCLEMAKRSADALLRLVNDILDFSRIEARKMVFESRPFDLTACVNSAVEILAFE
FT                   ARRKGLAVMVRMGPDVPAAVVGDEARLRQVLVNLIGNAVKFTDRGKVEVTAARAERQSD
FT                   PLRTAIRISVRDTGIGIAPQERERLFRVFSQVDGACNRRFGGTGLGLALTRDIVEAMGG
FT                   AIDVESQSGQGSTFTITIPLLLAVTASSPFLPADTLRIAEASAGGGTGAPVTPPISIQY
FT                   EEARKVKILLAEDDPITRKFMEIMLERRNFEFESASDGHEAVEKWEAGEFDVVLMDVQM
FT                   PRLDGYEATGLIRERERDRGRRTPIIALTAHAMRKDEDRCLDAGMDGYLSKPIDFTKLM
FT                   ECIGEILARRGRG"
     atgacccagt ccggcccaga agacggctcc ggcaatagcc ggatcggggc agcggaaatg        60
     ccggaagcgg ataccgagaa gcagcagccc gcgtctgatg ctccgagtca ggagctgcgg       120
     gatatccggg cgcaactgga gctctccctc gaacgttacg ccaacctcta ccacttcgcc       180
     cccgtcggct atgccaccat cgacgccgtc ggggtgatcg ccgacgccaa ccggaccctg       240
     gcggggatga tcggggccga ttgccgggag atggtggggc tcctcttcag cgactttgtg       300
     cacaaggatg acgtcacgtc cttcgtatcc catctggccc gctgtaccgg acagcgggag       360
     ggggtcaccg gcgagttccg cctcagcggc aggaacggca tatccgtgga cgttcagctg       420
     tcgagcatgc ctctcacgcc ccccggcggc cgggtctcgt gccgcacggc aataaccgac       480
     atcaccatga ttaagcgcaa ggagcgggag ctgaacgaga gccgcgagga actgtgctgg       540
     gccaaggagg cggccgagga tgccagccgt gccaagagcg agttcctggc caacatgagc       600
     cacgagatcc gcacccccat caacggtgtg ctcggcatgc tccagctggt tctcgacacg       660
     gagctggggg acgagcagcg tcactgtctg gaaatggcca agcgctccgc cgacgccctc       720
     ctgcgcctgg tgaacgacat cctcgacttc tcccgcatcg aggcgcggaa gatggtcttc       780
     gaaagccgtc ccttcgacct gacggcatgc gttaacagcg ccgtggaaat cctggccttc       840
     gaggcgcggc ggaaggggct tgccgtcatg gtccgcatgg ggcccgacgt ccccgcggca       900
     gtcgtggggg atgaggcccg gttgagacag gtgctggtga acctgatcgg gaacgccgtc       960
     aagttcaccg acagagggaa ggtggaggta acggcggctc gggccgagag gcagtccgat      1020
     ccccttcgca ccgcgatccg gatatcggta cgcgacaccg gtatcggcat tgctccgcag      1080
     gagcgggagc gtcttttcag ggtcttcagc caggtagacg gggcctgtaa ccgccggttc      1140
     ggcggcacgg gcctcggtct ggcgctgacc cgcgacatcg tggaagccat gggcggggcc      1200
     atcgatgtcg agagccagtc gggccagggg agcaccttta ccatcacgat cccgctcctg      1260
     ttggcagtga ctgcgtcctc gccctttctc cccgccgata cgcttcgcat agccgaggct      1320
     tcggccggag ggggcaccgg tgcgccggtc acccccccaa tttctattca atacgaggag      1380
     gcacggaaag tgaagattct tcttgccgag gacgacccca ttacccgcaa gttcatggag      1440
     atcatgctgg agcgtcgcaa tttcgaattc gagtccgcga gcgacggcca tgaagcggtt      1500
     gaaaaatggg aggcggggga gttcgacgtg gtgctcatgg atgtgcagat gccccgtctc      1560
     gacggctacg aggccaccgg cctgatccgc gagagggagc gcgaccgggg gcggcgcact      1620
     cccatcatcg cccttaccgc ccatgccatg cgcaaggacg aggaccggtg cctcgacgcc      1680
     ggcatggacg gctatctctc aaagcccatc gatttcacga agctcatgga gtgcatcggc      1740
     gaaatcctgg cccggcgggg acgggggtaa                                       1770
//

If you have problems or comments...

PBIL Back to PBIL home page