(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE687

CP002031.PE687       Location/Qualifiers
FT   CDS_pept        750506..750871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0700"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83563"
FT                   /protein_id="ADI83563.1"
FT                   /translation="MKHDERDERMIQTVRRELDRSTSDLDGAIAGRLAEIRAKAVAEAG
FT                   RRHFPFLPRWVTVGGVATLTAAAVAGIIWFSSPSVEPVPVAVQDDPEQIELIAANDHIQ
FT                   LYEDIEFYHWLAAQENQ"
     atgaaacatg acgagcgtga cgagcggatg attcaaacgg tcaggcgcga actcgaccgg        60
     agcaccagcg acctggacgg cgccattgcg ggacggctgg cggagatccg ggccaaggcc       120
     gtggcggagg caggacgccg tcacttcccg ttcctccccc gctgggtgac ggtgggcggg       180
     gtcgccaccc tgacagctgc cgcggtggcc ggcatcatct ggttttcctc cccgtcggtc       240
     gagccggtgc ccgtggcagt ccaggacgac ccggagcaga tcgagttgat tgcagccaat       300
     gaccatatcc aactgtacga ggacatcgaa ttctatcatt ggctggcggc ccaggagaat       360
     caatga                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page