(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE688

CP002031.PE688       Location/Qualifiers
FT   CDS_pept        750868..751425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0701"
FT                   /product="protein of unknown function DUF3106"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0701"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83564"
FT                   /protein_id="ADI83564.2"
FT                   /translation="MRSYARGPNVGEVMGSWRVILVCMMLGMAVSPAWGDGGGVSWERL
FT                   TPEQREVLQHFAERWNSFPPERQERLLDSAERWRAMAPEARRNALERYRHWHDLTQEQR
FT                   DLIRKRIKEFHKLAPADQERIKRSYQRFQNLPPQEREVLKGKWRSLSPEEKRQFKEKWR
FT                   SMTDEQRREFLRDRSTDDSGAR"
     atgaggtcgt atgcccgggg gccgaatgtg ggggaagtga tgggtagctg gcgtgtgatt        60
     ctggtctgca tgatgctggg catggcggtt tcgcctgcct ggggcgatgg gggcggggtg       120
     tcgtgggaac ggttgacccc cgagcagcgt gaggttcttc agcattttgc cgaacgctgg       180
     aacagttttc ctcccgagcg ccaggagcgc ctgctggaca gcgccgagcg ctggcgagca       240
     atggcgcccg aggcgcgtcg gaacgccctg gagcgatacc gtcactggca tgatctgact       300
     caggaacagc gcgatctgat ccggaagcgg atcaaggagt tccacaagct tgcccctgcc       360
     gatcaggagc gcatcaagcg ttcgtaccag cgcttccaga atcttccccc ccaggaacgg       420
     gaggttctca aaggaaaatg gcgttcgttg tcgccggagg aaaagcggca gttcaaggag       480
     aagtggcgct ccatgacgga cgaacagcga cgggagtttt tgcgggacag gtcaactgat       540
     gattccggcg cgcgctaa                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page