(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE70

CP002031.PE70        Location/Qualifiers
FT   CDS_pept        76773..77087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0071"
FT                   /product="DNA-binding protein, YbaB/EbfC family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82934"
FT                   /protein_id="ADI82934.2"
FT                   /translation="MSKGLAGIMKQAQMMQQKMAKLQEEAANRTAEATAGGGAVTAVVS
FT                   GKNQIVSLAIKPEAVDPEDVEMLQDLVVTAVNEALKKVQSQFAEEMSKVTGGLNIPGLF
FT                   "
     atgtccaagg gtttggccgg aatcatgaaa caggctcaga tgatgcaaca gaaaatggcg        60
     aaacttcaag aggaagccgc caatcggacc gccgaggcca ccgcgggggg cggcgcggtc       120
     accgccgtgg tgagtggcaa gaatcagatt gtttctctgg cgatcaagcc cgaggcagtt       180
     gatccggaag atgtcgaaat gcttcaggac ctggtcgtca cggccgtaaa tgaggcgctc       240
     aagaaggttc aatcccagtt tgccgaggag atgagcaagg ttacgggcgg actcaatatc       300
     cccggcctgt tttaa                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page