(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE709

CP002031.PE709       Location/Qualifiers
FT   CDS_pept        complement(770293..770787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0723"
FT                   /product="cytochrome p460, 1 heme-binding site"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0723"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83586"
FT                   /protein_id="ADI83586.1"
FT                   /translation="MKFMLAVLALTLAGAAASGAGELPVAPNGIACLTDYRAWEAVAPS
FT                   WRDDRGQIRVILGNPTAMKALRSGTRPFPDGSTFAKLAWSAKKHPKFPLATVPDAFAQV
FT                   EFMVKDGEKFKPTGGWGFARFVGQELKPYGKDASFVLECFGCHTPVKDNDFVFTHLATI
FT                   P"
     atgaaattca tgctcgcagt ccttgccctg accttggccg gcgcggccgc tagcggcgcc        60
     ggggagcttc cggtggcgcc caacgggatc gcctgtctca ccgactaccg ggcctgggaa       120
     gcggtggcac cgtcctggcg cgacgaccgg ggacagatca gggtaatcct cggcaacccc       180
     acggccatga aggccctgcg gagcggaacc cgccccttcc ctgacggctc aacctttgcc       240
     aagctggcct ggagtgcgaa aaagcacccg aagttcccgc ttgccacggt gccggacgcc       300
     ttcgcgcagg ttgaattcat ggtgaaggac ggggagaagt tcaagcccac cggcggctgg       360
     ggctttgccc gtttcgtggg gcaggagctg aaaccctacg gcaaggatgc ctcctttgtc       420
     ctggagtgct tcggctgcca cacccccgtg aaagacaatg atttcgtctt cacccacctg       480
     gctaccatcc cctga                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page