(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE715

CP002031.PE715       Location/Qualifiers
FT   CDS_pept        complement(774895..776235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0729"
FT                   /product="membrane protein, major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0729"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83592"
FT                   /protein_id="ADI83592.2"
FT                   /translation="MGASAQMEKVGTRLRLMLRALNSRNYRLFFAGQSVSLVGTWMQQV
FT                   AMSWLVYRLTGSALLLGVVGFVSQIPTFLLAPVAGVLADRWKRRPLLLATQTLAMVQAA
FT                   VLAVFVLTGTTPVWLIVALSALLGVVNAFDIPIRQSFVVELVEKKEDLGNAIALNSSMV
FT                   NGARLIGPSIAGVLVATLGEGICFLINAASYLAVIIAIAAMRLKPVPQRPGRKHILHEL
FT                   REGFGYAFDFKPIRYILMLLGLVSLMGMPYVVLMPIFAKEVLHGGAHTFGFLMASVGIG
FT                   AFGSTLYLASRTSVLGLGRVIAVAACVFGFGIAGFALSSSLVLSPLFLALAGFGAMAQV
FT                   ASSNTILQTIVDDDKRGRVMSFFTMSFMGATPIGSLMAGAVANRIGAQNTLLIGGAACL
FT                   LGGALFGRELRNLRPLVRPIYARLGIIPEVAAGMQAAADLTCPPEDP"
     atgggagcca gtgctcagat ggaaaaggtc gggacgcggc tacggctgat gctgcgggcg        60
     ctgaattcgc ggaattaccg gctgtttttc gccggacaga gcgtgtcgct ggtgggcacc       120
     tggatgcagc aggttgccat gagctggctc gtctaccggc tgaccggctc ggcactgttg       180
     ctcggggtgg tcggcttcgt cagccagatc ccgaccttcc tcctggcgcc ggtggccggg       240
     gtgctggccg accgctggaa acgccggccg ctcctccttg ccacccagac cctggccatg       300
     gtccaggcgg cggtgctggc ggtcttcgta ctgaccggga ccaccccggt ctggctcatc       360
     gtcgcgctga gcgccctgct cggggtggtc aacgccttcg acatcccgat ccgccaatcg       420
     ttcgtggtgg agctggtgga gaaaaaagaa gacctgggaa acgccatcgc cctcaactcg       480
     tccatggtca acggtgcccg gctgatcggc ccgtccattg ccggagtgct ggtcgccacc       540
     ctgggcgagg ggatctgttt cctgatcaat gcagccagct acctggcggt gatcatcgcc       600
     atagcggcga tgcggctcaa gccggtgccg cagcggcccg gccgcaagca tatcctccat       660
     gaactgcgcg aaggattcgg ctacgccttc gacttcaagc cgatccgcta catcctgatg       720
     ctcctcggcc tggtcagcct gatggggatg ccctacgtgg tgctgatgcc gatcttcgcc       780
     aaggaggtcc tgcacggcgg ggcccacacc ttcggcttcc tgatggcctc ggtcgggatc       840
     ggcgccttcg gcagcaccct ctacctcgcc tcccgcacaa gcgtcctcgg cctcggccgg       900
     gtgatcgcgg tggccgcctg cgtcttcggc ttcggcatcg ccggtttcgc cctgtccagc       960
     tcactggtcc tctcgcccct gttcctcgcc ctggccggct tcggcgctat ggcccaggtt      1020
     gcctccagca acaccatcct ccagaccatc gtcgacgacg acaaacgggg ccgggtgatg      1080
     agtttcttca ccatgtcgtt catgggagcc acccccatcg gcagcctgat ggccggggcc      1140
     gtggccaacc ggatcggcgc ccagaacacc ctgctgatcg ggggtgccgc ctgcctgctc      1200
     ggcggggcgc tcttcggccg ggagctgcgt aacctccgcc ccctggtccg gcccatctac      1260
     gcccggctcg gcatcattcc cgaagtggcg gccggcatgc aggccgctgc tgatctgacg      1320
     tgtccaccgg aagatcccta a                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page