(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE721

CP002031.PE721       Location/Qualifiers
FT   CDS_pept        complement(787078..787422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0735"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83598"
FT                   /protein_id="ADI83598.1"
FT                   /translation="MDTNNTHKTKCDLNLEEDVSIHIFTASAAMVGVCLTVIGLLRVAL
FT                   TIRGGVTLADDMLALDAFLFLASCILSYFALRTRSSRRMHRVERWADSIFITGLVLMVS
FT                   VCAIIVYEIV"
     atggatacca acaacacaca caagacaaaa tgcgacctca acctcgaaga agacgtgtcc        60
     atccacatct tcaccgcctc ggcggccatg gtgggggtct gcctcacggt catcgggctg       120
     ctgcgcgtgg cgctgaccat ccgcggggga gtaaccctgg cggatgacat gctcgcactc       180
     gatgcgttcc tcttccttgc gtcgtgcatc ctctcctatt tcgcgcttcg tacgcgcagc       240
     tcccgcagga tgcatcgcgt ggagcgctgg gccgattcca tcttcattac ggggctggtc       300
     ctgatggtgt ccgtgtgtgc cattatcgtg tatgaaatcg tgtag                       345
//

If you have problems or comments...

PBIL Back to PBIL home page