(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE722

CP002031.PE722       Location/Qualifiers
FT   CDS_pept        787644..788330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0736"
FT                   /product="protein of unknown function DUF554"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0736"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83599"
FT                   /protein_id="ADI83599.1"
FT                   /translation="MILTGTIANVATICAGALIGRYAGRFVPARTRRTVMAGLGLTVLL
FT                   IGLQLALKSRQPLLVIGGLIIGGILGEMLQIEARLEDFGRWLQARFSSAGNIAEGFVSA
FT                   SLLYCVGAMAIMGSLQDGLGDKPSILYAKAALDGVASIALASTLGIGVLFAALPVALYQ
FT                   GGITLAADVARGVLTEPVIVEMNAAGGLLIVAIALDMMELKRIPVGNLLPSVFVVVGLA
FT                   WAFGLA"
     atgatcctca ccggaaccat cgccaacgtc gccaccatct gcgccggcgc cctgatcggc        60
     cgctatgccg gccgcttcgt ccctgcccgg acgcgccgga cggtcatggc ggggctgggg       120
     ttgaccgtcc tcttgatcgg cctccaactg gcgctcaaga gccgccagcc gctcctggtg       180
     atcggcgggc tgatcatcgg cggcatcctc ggcgagatgc tccagatcga ggcccggctg       240
     gaggacttcg gccgctggct ccaggcgcgc ttctccagcg ccggcaacat cgccgagggg       300
     ttcgtctccg cgagcctgct ctactgcgtc ggcgccatgg ccatcatggg ctcgctccag       360
     gacggcctcg gcgacaagcc ctccatcctc tacgccaagg ccgcccttga cggcgtcgcc       420
     tccattgccc tggcctccac cctcggcatc ggcgtcctgt tcgccgcgct gcccgtggcc       480
     ctctaccagg gcggaatcac cctggccgcc gacgtggcca ggggggtgct gaccgagccg       540
     gtcatcgtgg agatgaacgc cgccggcggc ctgctgatcg tggccattgc cctcgacatg       600
     atggagttga agagaatccc ggtcggcaac ctgctgccgt cggtcttcgt ggtggtgggg       660
     ctggcgtggg ccttcgggct ggcgtga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page