(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE723

CP002031.PE723       Location/Qualifiers
FT   CDS_pept        complement(788570..790228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0737"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0737"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83600"
FT                   /protein_id="ADI83600.1"
FT                   /translation="MSRIIPLIVGAVLFCFSAASYALPAQLPLSKDLTVRLSALSAQGQ
FT                   LQTVAEVVARTDALGKIAFDFPTVPSSATTPFLHIRIMDGENVLRQAIVPSPQPGGTVD
FT                   AGVSEVTDLQARALLKATALSGRLTPVHMLVAHTLLRTPTISTTDAEAIGSAIVAGADA
FT                   LFAVLATDGLSSDQHAAFLGSLRNGLADAAGIYRKSVDDSIVFDQNVEAYRRGEAYAVL
FT                   LQSLIDAGIDAGINLETVSTAFAAAGAATEAALESNPAVGAVARAGMRLGYVTGMLSLS
FT                   NYRSIRELVAGFRHAGCSPPRFSRLHSVFDLVWQDTTTSLKAADRDLLASSSENDLQGL
FT                   RTQEFNAAARQDLQGLKLALESYDLRTIPESVELMLEITSRMAGQGGVMAGMTPEHLME
FT                   ILGRSTSASPESPPVPVDVPTLTPYELAAWAYIHTEPGFAYTPIAGLIDQLESKPTATP
FT                   QFDKLAEPYKSLALLTYDLILISRLYWQEQQDAETALEANQTDPPRWHPLATVRQISEN
FT                   NRQRLALARRHISGVSPEAKDALIYLVHANRFVRF"
     atgagcagaa tcattccatt gattgttggc gcggttctct tttgtttttc agcggccagc        60
     tacgcgttgc cggctcaatt accgttgagc aaggatctta cggtccggct ttcagccctc       120
     agcgcccagg gacagttgca gacagtggcc gaggtggtgg ccaggaccga cgcgctcggc       180
     aagatagcct ttgattttcc gacggttcca tcttcggcaa cgacaccgtt cctgcatatc       240
     cggatcatgg acggcgagaa tgtgttgcgg caggcgatcg tgccgagccc gcaacccggc       300
     gggaccgttg atgcgggcgt gagcgaggtg accgatctgc aggcgcgggc cctgctgaag       360
     gccacggccc tgtcgggcag gctgacgccg gtgcatatgc tggttgccca tacgcttctg       420
     cgaacgccca cgatcagcac aacggatgcc gaagccatag gttccgccat tgtggccggc       480
     gccgatgccc tgttcgctgt tctggcaacg gatggcctga gctccgacca gcacgccgca       540
     tttctggggt cactaagaaa cggactggcc gatgccgccg ggatctatcg caaatcggtc       600
     gatgattcga ttgtgttcga tcagaacgtc gaggcatacc ggcggggcga ggcgtatgcg       660
     gtactcctgc agtcgttgat cgacgccggc attgatgcgg gaataaacct ggagaccgtc       720
     tcaactgctt ttgctgcggc cggagcggca acagaggcgg cactggagag caatcccgct       780
     gtcggggctg ttgcgagggc aggcatgcgg ctggggtacg tcaccggcat gttgagtctg       840
     agcaattaca ggtcgattcg ggaactggtt gccggcttca gacatgccgg ttgttcgccg       900
     ccgaggtttt ccagactcca ttccgtattc gatctggtgt ggcaggacac aaccaccagc       960
     cttaaggcag cggatcgtga cctgctggca agctcatcgg aaaacgacct ccaaggattg      1020
     agaacccagg aattcaatgc cgcagcaaga caggatctgc agggactgaa gcttgcgctt      1080
     gaaagttatg atcttcgcac aattcccgag tctgttgagc tcatgctgga aatcacttcg      1140
     cgcatggcgg gccagggtgg ggtaatggcc ggcatgactc ctgaacacct gatggaaatt      1200
     ctggggagat cgacatcggc atctccggag tcgccccccg tgccggttga cgtgccaacc      1260
     ctgacaccct acgagttggc ggcctgggca tatattcaca cggagcccgg gtttgcgtat      1320
     accccgattg cgggactcat cgaccagctt gagagcaagc cgacggccac ccctcagttc      1380
     gacaaactgg cagagcccta caaatccctg gcattgttga cgtacgatct tattttgatc      1440
     agcagattgt attggcagga acaacaggat gccgaaaccg cccttgaggc gaaccaaacg      1500
     gatccgccac gctggcaccc ccttgccact gttcggcaga tatctgaaaa caatcgccaa      1560
     cgattggccc tggcccgccg gcatatatcc ggcgtatcac cggaagcgaa agacgccttg      1620
     atctatctgg tacatgcgaa ccggttcgtc aggttttag                             1659
//

If you have problems or comments...

PBIL Back to PBIL home page