(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE728

CP002031.PE728       Location/Qualifiers
FT   CDS_pept        complement(793839..794495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_3420"
FT                   /product="DUF74 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_3420"
FT                   /db_xref="EnsemblGenomes-Tr:ADN78316"
FT                   /protein_id="ADN78316.1"
FT                   /translation="MDIQEAWKKAYDLHYKSKNEDNKNEALILYREISSQHPYSEEGKY
FT                   SLCQIENLRKSNPELFNEDSNTSAANPITLITDKSICTTCHSTISGYNEDGMCAACFVQ
FT                   YLNENIIMTTTNNIDGFKVTKYIDIKSVEIIMGTGFISETFSDIADIFGARSVLFEGKL
FT                   ADAKRIATEQLRYAAYKIGGNAVIGIDLDYTEFSSNRVGVIISGTIVKIIPITNI"
     atggatattc aagaagcctg gaaaaaggca tatgacttac actacaaatc aaaaaatgag        60
     gataacaaaa atgaagcgct gattctctat cgtgaaatat cttcgcaaca tccatattca       120
     gaggaaggaa aatactccct gtgccaaatt gaaaatctaa gaaagtcaaa tcctgaactg       180
     tttaacgaag actcaaacac atcagcagct aatcccatca cattaattac agataaatca       240
     atatgcacaa catgccactc taccatttca ggctacaacg aagacggtat gtgtgcggca       300
     tgttttgtcc aatatctgaa tgaaaatatc attatgacta ctacgaataa cattgacggc       360
     ttcaaagtga ctaaatatat cgacataaaa agtgtagaaa taataatggg gacaggtttt       420
     attagtgaaa cttttagcga tattgctgac atttttggtg caagatcagt gttgtttgaa       480
     ggtaaattag ctgacgcaaa acgaattgct acagaacaat tacgctatgc tgcttacaaa       540
     atcggtggta atgcagttat tggaattgac cttgattaca ctgagttttc aagtaataga       600
     gttggggtaa ttataagcgg aacaatagta aaaataatcc caataacaaa tatttag          657
//

If you have problems or comments...

PBIL Back to PBIL home page