(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE730

CP002031.PE730       Location/Qualifiers
FT   CDS_pept        complement(795455..796522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_3422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_3422"
FT                   /db_xref="EnsemblGenomes-Tr:ADN78318"
FT                   /protein_id="ADN78318.1"
FT                   /translation="MKKRAKMLFDKSLDSLLLSIEHFNRPWDRGRPEAVLILMDRAFEL
FT                   LMKAIILNKGGKIREPFQKETIGHEKCVRKCITDAQVKCMTEEQGLTIQIINSLRDAAQ
FT                   HDIVEVAERDLYLYSQAGVTLYRDMIMDQFNEDLRDHFPERVLPVSTEIPKDLHAIVEA
FT                   DFEEIKELVRPGARRHIEAMAKLKALAIIESSLEGVRLQPSEPELMKLAKEVKAGKSWQ
FT                   DIFPGVASLQLATDGEGLNVHVRITKKEGDAVHVVPEGTPGATVLAVKRVNELDFYSLG
FT                   IKNIADQLGISDKKALALVDKLGLQSSEDFFKVIKIGKNEFKRYSGRALKTLREELPKV
FT                   NIDEVWQEYVAKRRG"
     atgaaaaaac gagcgaaaat gcttttcgat aaatcattgg actctctcct gctttcgatt        60
     gagcacttca atcgaccttg ggatcgtggg cggccagagg cagttctaat cctcatggat       120
     cgtgcctttg aactacttat gaaggcaata atattgaaca aaggcgggaa aatccgtgag       180
     ccattccaga aggaaacgat aggccatgag aagtgtgtac gaaaatgcat taccgatgcc       240
     caagtaaaat gcatgactga ggagcaaggc ctcacaattc aaataatcaa cagcctacga       300
     gatgctgcgc aacatgacat agttgaagta gctgaacgtg acctatattt gtatagccaa       360
     gcaggcgtca cactttaccg agacatgatt atggatcaat tcaacgagga tcttcgagat       420
     cactttcccg aaagggttct gcctgtttct accgagatac cgaaagactt gcatgcaatt       480
     gttgaggctg attttgagga aattaaagaa cttgttaggc caggagcaag acgtcacatt       540
     gaggctatgg cgaaacttaa agcacttgca atcatagagt catctcttga aggggtacgt       600
     ttgcaaccaa gcgagccaga acttatgaaa ctggcaaaag aggtaaaggc aggtaaatct       660
     tggcaagata ttttcccagg tgttgcgagc cttcagcttg ccaccgatgg tgaaggtctt       720
     aatgtgcatg ttcgtataac aaaaaaggaa ggagacgcag tacatgttgt ccctgaaggg       780
     actccaggcg ctacggttct agccgttaag cgtgtgaacg aactggattt ttactccctt       840
     ggaatcaaaa atattgctga tcaacttggc attagtgaca aaaaagcgtt ggcactcgtt       900
     gacaagctcg gtcttcaatc ttcagaggac ttctttaagg ttatcaagat cggaaaaaat       960
     gaatttaagc gctactcagg aagggcgttg aaaacactcc gagaagagct tccgaaagta      1020
     aatattgacg aggtatggca ggagtatgta gcgaagcgca ggggttaa                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page