(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE75

CP002031.PE75        Location/Qualifiers
FT   CDS_pept        83036..84814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0076"
FT                   /product="ABC transporter, ATP-binding/membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82939"
FT                   /protein_id="ADI82939.1"
FT                   /translation="MHYGSAYEDEIVGKAYDRGLMLRFIRYVHPYRWLALAALVLLPLS
FT                   AAARLAQPLVLKAAIDDHIVTGRLEGLPLVAAGFLLLIVAESLITFLEVWLLQYLGQRV
FT                   MLDLRLELFAHVQRLPVSFFDRTATGGLVTRLTSDVEVLGEMFAAGIITVVGDILFLAG
FT                   IVGVMLWLNPPLSLITFSVLPLLVWVAFTFRIRMRKAFREVRARLANLNTFLAETIGGM
FT                   SVIQLFNRQAGERAEFSRLNGSYRDANLPVITWDASLYALVETLSSVAVGLIIWYGGGE
FT                   VLRGALTFGALVAFIQYIEKFFGPIRDLSAKYSIMQGAMAALERIFGLLDTAPDHDAGV
FT                   SGPAVSAGAPPIETIRFRNVWFAYQEDDYVLRGIDLTIRRGETVALVGETGGGKTTVTR
FT                   LLSRFYDVNRGDILFNGDDVRSIPLSELRRRIGVVLQDPYLFTGTVGFNIHLGDERARA
FT                   RMDDAARLVGADRFIRLLPGGYDEQVRERGSNLSAGERQLISFARAVAFDPEILVLDEA
FT                   TASIDTESERLIQDGLAALMAGRTSIVVAHRLSTVQGADRIVVIHRGEKVEEGTHGELL
FT                   AQGGIYARLYQLQFRD"
     atgcactacg gcagcgccta cgaagatgaa atagtcggca aggcatacga tcgggggctc        60
     atgctgcggt tcatccgcta tgtgcatccc tatcgctggc tggcgctggc ggcgctcgtg       120
     ctcctgccgc tctcggcggc ggcccggctg gcgcagccgc tggtcctcaa ggccgccatc       180
     gacgatcaca tcgtcacggg acggctggag ggattgccgc tggttgccgc agggtttctc       240
     ctgctcatcg tggccgaatc gctgataacc tttctcgaag tgtggcttct ccagtacctg       300
     ggacagcggg taatgctcga cctgcggttg gagctgttcg cccacgtgca gcgacttccc       360
     gtctctttct tcgaccgtac cgccaccggc ggcctcgtga cacggcttac cagcgacgtg       420
     gaggtgctcg gcgaaatgtt tgccgccggc atcataactg ttgttggcga catcctcttt       480
     ctggccggta tcgtcggcgt aatgctctgg ttgaaccccc cgctttcgtt gatcaccttt       540
     tcggtgctgc cgctgcttgt ctgggtcgct ttcacattca ggatcaggat gcgcaaggcg       600
     tttcgggagg tgcgcgcccg cctggcgaac ctgaacactt ttttggccga aaccatcggc       660
     ggaatgtcgg tgattcagct cttcaaccgg caagccgggg agcgcgccga gttttctcgg       720
     ctcaacggct cataccgtga tgccaatctg ccggtcatca cctgggacgc ctctctctac       780
     gctcttgtgg agacactctc ctcggtggct gtcggcctca tcatctggta cggcggagga       840
     gaggtcctca ggggagccct taccttcgga gcgctggttg ccttcattca gtacatcgag       900
     aaatttttcg gcccgatccg ggacctgtcg gcaaaatact ccatcatgca gggcgccatg       960
     gccgcccttg agcggatctt cggcctgctc gacacggcac ccgatcatga cgccggggtc      1020
     agcggtcctg ccgtcagcgc cggcgcgcct cccatcgaaa ccatccggtt tcgcaacgtc      1080
     tggtttgcct accaggagga cgactacgtc ctgcgtggaa tcgacctgac gattcgccgg      1140
     ggcgagaccg tggcgctcgt tggggagacc ggcggcggca agacgacggt gacccgactc      1200
     ctttcgcgct tctacgacgt aaataggggc gacatccttt tcaacggcga tgatgtccgc      1260
     tcaatccccc tgtcagagct ccgccgacgg atcggggtgg ttctccagga cccttatctc      1320
     ttcaccggca cggtgggctt caacattcat ctgggagacg agcgtgcccg tgcccggatg      1380
     gatgacgcag cccgactggt gggggcagac cgctttatcc gtctcctccc cggaggttac      1440
     gatgagcagg tgcgcgagcg agggagcaac ctgtcggccg gggagcgcca actcatttcc      1500
     tttgcccgcg ccgttgcctt cgaccctgag attctcgtgc tggacgaagc aaccgccagc      1560
     atcgacaccg agtcggagcg gctcattcag gacgggcttg ccgcactcat ggctggtcgc      1620
     acttccattg tggtggcgca ccgcctctcg acggtccagg gggcggaccg gatagtggtc      1680
     atccaccggg gagaaaaggt agaagagggg acccacggcg agctcctggc gcaagggggc      1740
     atctatgcac ggctctatca gcttcagttc agggattga                             1779
//

If you have problems or comments...

PBIL Back to PBIL home page