(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE761

CP002031.PE761       Location/Qualifiers
FT   CDS_pept        complement(827630..828184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0773"
FT                   /product="NosL family protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0773"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83636"
FT                   /protein_id="ADI83636.1"
FT                   /translation="MRQFRKLFCLALSLTMTIVVFTAGVGAASSHGKDVSAHKSCQYCG
FT                   MDREKFAHSRMLIEFEDGTTVATCSLHCVAVDLANNIDKAPKSIMVADYSTKQLIDAEK
FT                   AYWVIGGSKQGVMTRNAKWAFAAKDAAEAFIKENGGRPASFDEAIKSAYEDMYSDTKMI
FT                   RDKRKQMKMKRDGHAKGSDMK"
     atgaggcaat tccgtaagct gttctgtctg gccctgtcgc tgaccatgac catcgttgtt        60
     ttcacggccg gggttggcgc cgcatcgagc cacgggaagg acgtttcggc ccacaaatcg       120
     tgccagtact gcggcatgga tcgggagaag ttcgcacaca gccgcatgct gatcgagttc       180
     gaggacggca ccaccgtagc cacctgcagc ctgcattgcg tcgcagtcga cctggcaaac       240
     aacatcgaca aggccccgaa gtccataatg gtggccgact actccaccaa gcaactcatc       300
     gatgccgaaa aggcctattg ggttatcggc ggcagcaaac agggggtaat gaccagaaat       360
     gccaagtggg cctttgccgc caaggatgcg gcggaagcgt tcatcaagga aaacggcggc       420
     aggccggcct cctttgacga ggccatcaag tccgcctatg aggatatgta ttccgacacc       480
     aaaatgatcc gcgacaagcg caaacagatg aagatgaagc gggacgggca cgcaaaggga       540
     agcgacatga aatag                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page