(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE762

CP002031.PE762       Location/Qualifiers
FT   CDS_pept        complement(828313..829995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0774"
FT                   /product="FAD-dependent pyridine nucleotide-disulfide
FT                   oxidoreductase family protein, rhodanese homology
FT                   domain-containing"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0774"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83637"
FT                   /protein_id="ADI83637.1"
FT                   /translation="MKMSIVVIGANAAGAKAASKAKRINPTAEITLIDRGTFISYGACG
FT                   IPYFVSDTVEDVKELMSTPVGVVRDHQFFRKVKGVTVKTATEVIAIDRAAKTVCMRDCQ
FT                   TSRETKLPYDRLVLATGSTPFIPQISNVNLANVLTVKSIEDAELLKSLAVPGTRACIVG
FT                   GGLIGLETAEALRHKGLQVAVVEMRDQMLPGVLDWEMAALVEKQLRQQGVTVMTGSAVT
FT                   GLVGDAAVEAVQIGDVRIPADLVVLAPGVAPNVELARGAGLEIGPTGAIAVDTRQCTTD
FT                   PDIYACGDCCETTHLITGKKVFIPLGSTANKQGRVAGINAAGGEATFAGVIGTSILRVF
FT                   AVNAGKTGLTEAEAKAHGFEVETVLSPSHDKAHFFPGAKPIILKLVAERGTGRILGLQA
FT                   VGEGAVDKRLDAAATAITFGATAEQVAQLDLAYAPPYSAAMDNLIVAADILKNKLAGHA
FT                   RGITPREVKRKFDEGDDFILLDVRSPAEHNAVGIEGAKLIPLGMLREKLEELPRDKEII
FT                   AFCKISLRGYEAQKILDAAGFRNAKFMDGGILAWPFALRTSDK"
     atgaagatga gcattgtggt gatcggcgca aacgccgccg gcgccaaggc ggcctcgaaa        60
     gcgaagcgga tcaacccgac agccgaaata accctgattg accggggcac cttcatttcc       120
     tacggtgcct gcggtattcc ctatttcgtt tctgataccg ttgaagacgt gaaggagctg       180
     atgagcacgc ccgtcggcgt cgttcgcgac catcagttct tcaggaaggt caagggcgtg       240
     accgtcaaga ccgctaccga ggtcattgcg atcgatcgcg cagcaaaaac cgtatgcatg       300
     cgtgattgcc agacatcccg ggaaacgaag ctcccttatg accgcctggt tctggccacc       360
     ggcagcaccc cgttcatccc gcagatcagc aacgtcaatc tggccaatgt tctcaccgtc       420
     aagagcatcg aggatgccga actgcttaag agtctggctg ttcccggcac ccgggcctgt       480
     atcgtcggcg gcggactgat cgggctggaa acggctgaag cgctgcgtca caaggggttg       540
     caggtagcgg tcgtcgaaat gcgggaccag atgctgcccg gcgtactgga ctgggagatg       600
     gcggcactgg tggaaaagca actcaggcag cagggcgtca ccgtcatgac cggcagcgcg       660
     gtgaccggcc tcgtcggtga tgccgccgtc gaggcggtac aaatagggga cgtgcggatc       720
     ccggccgatc tggtggtcct tgctcccggc gttgccccca atgtcgagct ggcccgcggc       780
     gccggactgg agatagggcc caccggagcc attgcggtcg atacgcgcca atgcaccacc       840
     gatcccgaca tctacgcctg cggcgactgc tgcgaaacca cgcatctcat taccggcaaa       900
     aaggtgttca tccccctggg gagcaccgcc aacaagcagg gccgggttgc cgggatcaat       960
     gccgccggcg gcgaggcaac ctttgccggg gtcatcggca ccagcattct gcgggtattc      1020
     gctgtcaatg ccggcaaaac gggtctcacc gaggcagagg ccaaggcgca cgggttcgag      1080
     gtggagactg tcctgtcgcc gtcccacgac aaggctcact tcttccccgg ggccaagccc      1140
     atcattctca agctggttgc cgaacggggc accggccgga ttctcggcct gcaagccgtg      1200
     ggcgaaggcg ccgtcgacaa gcggctcgac gccgccgcca ctgccatcac gttcggcgca      1260
     accgccgagc aggtggcgca gctcgatctc gcctatgcgc cgccctactc cgccgcgatg      1320
     gacaatctga tcgttgccgc cgacatcctg aaaaacaagc tggccggcca tgcccgcggc      1380
     atcacgcccc gggaggtgaa acgcaagttc gatgagggtg atgacttcat cctgctcgat      1440
     gtccgttcgc cggcagagca caacgcagtg gggatcgaag gcgccaagct gatcccgctc      1500
     gggatgctgc gggagaagct tgaggaactg cccagggaca aggagatcat cgccttttgc      1560
     aagatcagcc ttcgcggcta tgaggcccag aagatcctcg acgcggcagg cttcaggaat      1620
     gcaaaattca tggacggcgg gattctggcc tggccgttcg ccctcaggac ttctgacaaa      1680
     tag                                                                    1683
//

If you have problems or comments...

PBIL Back to PBIL home page