(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE763

CP002031.PE763       Location/Qualifiers
FT   CDS_pept        complement(830058..830366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0775"
FT                   /product="rhodanese homology domain superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0775"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83638"
FT                   /protein_id="ADI83638.1"
FT                   /translation="MRSNELLKRRKANNPPTVIDVRTGFEFKAGHVPGAVHAPAWKILL
FT                   MLARLPADKSAELVVTCEHGPRAQMAKGLLGLYGYRNVELLDGHMSAWRQAGHPLEK"
     atgcggtcca atgaattgct gaaacgcagg aaagcgaaca acccgccgac ggttatcgat        60
     gtccggaccg gctttgagtt caaggccggt cacgtccccg gcgcggtcca tgccccggcc       120
     tggaaaatcc tcctgatgct cgcccgtctc cccgccgaca agagtgcgga gctggtggtc       180
     acctgcgaac acggaccgcg cgcccagatg gccaaggggc tgctcgggtt atacggctac       240
     cggaatgtgg agttgctgga cgggcacatg tccgcctggc ggcaggccgg ccatcccctg       300
     gaaaagtga                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page