(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE767

CP002031.PE767       Location/Qualifiers
FT   CDS_pept        complement(831908..832681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0778"
FT                   /product="amino acid ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0778"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83641"
FT                   /protein_id="ADI83641.1"
FT                   /translation="MSDVKPLIQLENITKRFKSLTAVNGVNLAVHPGEKLVIIGPSGSG
FT                   KSTLLRSINFLEEIDEGTIRFEGNEVGYVRRHGKLHLDKQPVICALRAEIGMVFQHFHL
FT                   FPHMTVLGNVMEGPLTVQKKSAAESREIALAMLAKVGLTDKKDVYPATLSGGQKQRVAI
FT                   ARAIAMRPKLMLFDEPTSALDPELVGEVFDTIHALADEGMTMIIVTHHMGFARELADRV
FT                   IFMEKGNFLAEGTPQEFFAEGMNNERIQSFLNRIL"
     atgagcgacg ttaagcccct catccaactg gagaacatca ccaagcgctt caagagcctc        60
     acggcggtga acggcgtcaa cctggcggtc catccggggg aaaagctcgt gatcatcggc       120
     ccgtccgggt cgggcaagtc gacgctgctc cgctccatca acttcctgga ggagatcgac       180
     gaggggacca tccgcttcga gggaaacgag gttggctacg tccggcgcca cggcaagctc       240
     catctggaca agcaaccggt gatctgcgcc ctgcgggccg agatcgggat ggtcttccag       300
     cacttccacc tctttcccca catgacggtc ctcggcaacg tgatggaagg ccccctcacc       360
     gtgcagaaga agagcgccgc cgagtcccgg gaaatcgccc tggccatgct ggccaaagtg       420
     gggctcaccg acaagaagga cgtctacccc gccaccctct ccggcggcca gaagcagcgg       480
     gtggccattg cccgggccat tgccatgcgg ccgaagctca tgctcttcga cgagcccacc       540
     tcggccctgg acccggagct ggtcggggag gtcttcgaca ccatccacgc cctggccgac       600
     gaggggatga ccatgatcat cgtcacccat catatgggct ttgcccggga actggccgac       660
     cgggtgatct tcatggaaaa ggggaacttc ctggccgagg ggacccccca ggaattcttt       720
     gccgaaggga tgaacaacga gcggatccag tcgttcctga accggattct gtga             774
//

If you have problems or comments...

PBIL Back to PBIL home page