(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE768

CP002031.PE768       Location/Qualifiers
FT   CDS_pept        complement(832668..833690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0779"
FT                   /product="ABC transporter, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0779"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83642"
FT                   /protein_id="ADI83642.1"
FT                   /translation="MNLKPYTLGRVATALLFLWITTATALASEADYDALFREANDLMGA
FT                   GDLPAAMEVLKKVPAPRAGEEGDAFVRSRMQIAKLHFAAKEMDEALAAAREVLSLYPDN
FT                   SEAKNFTASVEREKKPGYVTFLQDCLKFLPVLLKGAVMTLLLVLCTMFISPIGGLLIAL
FT                   GRISTFRPLSALCWFVIWLFRGTPLLLQLFFIYYGLPSLGITLKPITAAVIGLGLNYSA
FT                   YLGEIIRGAIQSIDHGQTEAAKALGMTYGQTMRRVVIPQTYKRLMPPIGNEFIALIKDT
FT                   ALVSTIAMVELMRAADQMFNTYFNVTALILAAVIYLIFTTFFTFLFEKIEHRAGIYERR
FT                   "
     atgaacctta aaccatacac tctcggcagg gtcgctacgg ccctgctttt tttgtggatc        60
     accactgcaa cggcgttggc gtccgaagcc gattacgacg ccctcttccg cgaggccaat       120
     gacctcatgg gggcaggaga tctccccgcc gccatggagg tactgaaaaa ggtcccggcg       180
     ccccgggcgg gcgaagaagg tgatgccttt gtccggagtc ggatgcagat cgccaagctc       240
     cacttcgcgg ccaaggagat ggacgaggcc ctggccgcgg cccgggaggt gctttccctc       300
     taccccgaca acagtgaggc gaaaaacttc acggcctcgg tggagcggga gaagaagccc       360
     ggctacgtca cgttccttca ggactgcctg aagttcctgc cggtgcttct caagggtgcg       420
     gtgatgacgc tcctgctggt gctctgcacc atgttcatct ctcccatcgg cgggctcctc       480
     atcgccttgg ggcggatcag caccttcagg cccctgtcgg ccctctgctg gttcgtcatc       540
     tggctcttcc ggggcacccc cctcctgctt cagctcttct tcatctacta cggcctcccc       600
     tccctcggca tcaccctcaa acccatcacc gccgcggtca tcggcctggg gctcaactac       660
     tcggcctacc ttggcgagat catccgggga gccattcaga gcatcgacca cggccagacc       720
     gaggcagcca aggccctggg catgacctat ggccaaacca tgcgccgggt cgtcatcccc       780
     cagacctaca agcggctcat gccccccatc ggcaacgagt tcatcgccct gatcaaggac       840
     acggccctgg tttccaccat tgccatggta gagctgatgc gggccgcgga ccagatgttc       900
     aacacctact tcaacgtgac ggccctcatc ctggccgccg tcatctacct gatcttcacg       960
     accttcttca ccttcctctt cgaaaagatc gagcaccggg cagggatcta tgagcgacgt      1020
     taa                                                                    1023
//

If you have problems or comments...

PBIL Back to PBIL home page