(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE777

CP002031.PE777       Location/Qualifiers
FT   CDS_pept        complement(842455..843417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0788"
FT                   /product="diguanylate cyclase, CAP_ED domain-containing"
FT                   /note="domains: CAP_ED, GGDEF"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0788"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83651"
FT                   /protein_id="ADI83651.1"
FT                   /translation="MSRNHLPFSAGELEALPLFRFVPLECIEGILEHSCVVSLERGERF
FT                   EPAGPLGRTIHLILDGRLALYYDVRERDDTPLHLERGDIVGQSLVSGEPEVPCTLVAAE
FT                   ETRLMILEEDLIWSLAQASHAAACNLLGILLRGRGGSPQESFSGTVRDYALRNQAVVDP
FT                   LTGFQSRRWLEGILSRQVDRFTANGRPLSLVMIDIDGFRAFNERHGRAGGDRALHDVAK
FT                   TLRNSLRPGELVARYGGDTFAVLLPETEPSTAWMIADRLRQRLMRTVIDMGDGAMLPPL
FT                   SISAGVAEATPGIDGPTIADNALAALDRAKAAGGNTVSR"
     atgtccagga accacctgcc gttcagcgcc ggcgaactgg aagcgctgcc cctgttccgc        60
     ttcgttcccc tcgagtgcat cgaaggcatt cttgagcaca gttgcgtggt cagcctggag       120
     cggggcgagc gctttgagcc ggccggccct ctgggtcgaa ccatccacct gatcctggac       180
     ggccgcctcg ccctctacta cgacgtccgg gaacgggacg acacgcccct gcacctggag       240
     cggggcgaca tcgtcggtca aagcctcgtt tccggtgagc cggaagtccc ctgcaccctc       300
     gtggccgctg aagaaacgcg gctcatgatc ctggaggagg acctgatctg gtccctggcc       360
     caggcatccc acgcagccgc ctgcaacctg ctcggcatcc ttctgcgcgg caggggaggc       420
     tctccccagg agagcttctc ggggaccgtg cgcgactacg ccctccgcaa ccaggcggtg       480
     gtggaccccc ttaccggttt ccagagcaga cggtggctgg aggggattct ctcgcggcag       540
     gtggatcgct tcaccgccaa cggccggccc ctgtccctgg tgatgatcga catcgatggc       600
     tttcgcgcgt tcaacgagcg ccacggtcgc gccggcggcg accgggccct gcacgacgtc       660
     gccaaaaccc tccggaactc cctccgcccc ggcgagctgg tggcgcgcta cggcggcgac       720
     accttcgcgg tgctcctccc cgaaacggaa ccatccacag catggatgat cgcggaccgg       780
     ctcaggcaac gcctgatgcg caccgtcatc gacatggggg acggcgccat gctgccgccg       840
     ctctccattt cggcgggggt ggccgaagcc accccgggca tcgacggacc caccattgcg       900
     gataacgcgc tcgcggcgct cgacagggca aaggcagcgg ggggcaacac cgtttcccgt       960
     tag                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page