(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE787

CP002031.PE787       Location/Qualifiers
FT   CDS_pept        complement(853553..855178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0798"
FT                   /product="aldehyde dehydrogenase family 11 protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0798"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83661"
FT                   /protein_id="ADI83661.1"
FT                   /translation="MSIAERIPTFFPSPDEIPPQQLLSAPVELRDYLLNGELRHWQGAV
FT                   QDVFSPVCVRTPGGPERVRIGSFPLMGEADAHAALDAATAAYDCGRGRWPTMGVADRIR
FT                   HVQHFASLMKEQREAVVRLIMWEIGKTRSDAEKEFDRTVVYITDTIDALKELDRVSSRF
FT                   VIEQGIIGQIRRGPLGVALCMGPYNYPLNETFTTLIPALIMGNTVVMKPPRHGVLLFAP
FT                   LLAALREAFPPGVVNVLLGAGRALTPTLMRSGRIDVLAFIGTSKAANTLLKDHPRPNRL
FT                   RLVLGLEAKNPAIVLPDADLNLAVEECLAGSLAFNGQRCTALKLLFVHESVAQQFIALF
FT                   SRALSAIGTGMPWQAGVMITPLPEEGKTAYLEELLADASARGAAVVNEGGGTVTGTYFH
FT                   PALVYPVAPGMRLYTEEQFGPVVPIVPFTDIEEPIRAIRESDYGQQVSIFGRNSALLAP
FT                   LIDHLVNQVSRVNINSQCQRGPDVFPFTGRKDSAVGTLSVSDALRAFSLRTLVAARNHE
FT                   INKEIITDIVRERRSTFLSTDFIL"
     atgtccatcg cggaacgcat ccccaccttc ttcccttccc cggatgaaat ccctccccag        60
     cagctcctgt ccgctccggt ggaactgcgg gactacctgc tgaacggcga gctccgccac       120
     tggcaggggg ccgttcagga tgtattctcc ccggtctgcg tccggacacc cggcggcccc       180
     gagcgcgtac ggatcggaag cttccctctc atgggcgagg ccgacgccca tgccgccctc       240
     gatgccgcca ccgcggccta cgactgcggc aggggacggt ggcccaccat gggagtggcc       300
     gaccggatcc ggcatgtaca gcacttcgcg tccctcatga aggaacagag ggaagcagtg       360
     gtccggctga tcatgtggga gatcggcaag acccgttccg atgcggaaaa ggaattcgac       420
     cggaccgtcg tctacatcac cgacaccatc gacgccctca aggagctgga ccgggtctcc       480
     tcccgcttcg tgatcgagca agggatcatc ggccagatcc gccggggccc gcttggggtg       540
     gccctctgca tggggcccta caactatccc ctcaacgaga ccttcaccac cctgatcccg       600
     gccctgatca tggggaacac ggtggtcatg aagcccccgc gccacggggt gctcctgttc       660
     gcgccgctcc tggccgccct gcgcgaggcg ttccctccgg gggtggtaaa cgtactgctc       720
     ggcgccggac gtgccctgac ccccaccctg atgcggtccg gccggatcga cgtgctggcc       780
     ttcatcggca cgagcaaggc ggccaataca ctgctgaagg atcatccccg ccccaaccga       840
     ctccggctgg tcctggggct cgaagcgaaa aaccccgcca tcgtcctgcc tgacgccgat       900
     ctcaacctgg cggtggagga atgcctggcc ggcagcctcg ccttcaacgg ccagcgctgc       960
     acggccctga agctcctctt tgtccacgaa tccgtggcgc agcagttcat tgccctcttt      1020
     tcccgggccc tgtcggccat cggcaccggc atgccctggc aagcgggggt gatgatcacc      1080
     cccctgcccg aggaggggaa gaccgcctac ctggaggaac tgctggccga tgcctcggcc      1140
     cgcggggcag cggtggtgaa cgaggggggc ggcacggtca ccggcaccta cttccacccg      1200
     gccctggtct atccagtggc gccggggatg cgcctctaca ccgaggagca gttcggaccg      1260
     gtagtgccaa tagtcccgtt caccgacatc gaggagccga tccgcgccat ccgcgaatcg      1320
     gactacggcc agcaggtaag catcttcggc cgcaacagcg ccctgctggc accgctcatc      1380
     gaccatctgg tgaaccaggt gtcacgggtc aacatcaaca gtcagtgcca gcggggtccc      1440
     gatgtcttcc ccttcaccgg ccgcaaggac tcggccgttg ggaccctgtc ggtgtcggac      1500
     gccctgcgcg ccttctcgct ccggaccctg gtggcggcac gaaaccacga aatcaacaag      1560
     gaaatcatca ccgacatcgt gcgagagcgg cgctccacct tcctctcaac ggacttcatc      1620
     ctgtga                                                                 1626
//

If you have problems or comments...

PBIL Back to PBIL home page