(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE794

CP002031.PE794       Location/Qualifiers
FT   CDS_pept        861160..861582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0805"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0805"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83668"
FT                   /protein_id="ADI83668.1"
FT                   /translation="MTELDKALTVLRQDMTDAKSQSAFYDLFLNATFYVPILDEAAEVE
FT                   DNAAQKGEVLPLVIEAEGNDYLMLFDTKERLQEWTQADARYVEVPGYVLAATTMPPLHW
FT                   ALNAGTEYSKQFLPDEIAWLRDVVERCNAAAAKQQG"
     atgaccgaac tcgacaaagc cctgaccgtt ctgcgtcagg acatgaccga tgccaagagc        60
     cagtcggcct tttacgacct gttcctcaac gccaccttct atgttccgat tctggacgaa       120
     gccgcggaag tggaggacaa cgccgctcag aagggtgagg tgctgccgct cgtcatcgaa       180
     gcggagggca atgactacct gatgctgttc gacacgaagg agcgcctgca ggaatggacg       240
     caggccgatg cccgctacgt ggaagtgccg gggtacgtgc tggccgccac caccatgccg       300
     ccgctgcact gggcgctgaa tgccggcacc gagtactcca agcagtttct ccccgatgag       360
     atcgcatggc tgagggatgt ggtcgaacgc tgcaacgcgg cggccgcgaa gcagcaaggg       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page