(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE8

CP002031.PE8         Location/Qualifiers
FT   CDS_pept        11778..14066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0008"
FT                   /product="sensor histidine kinase, HAMP and PAS
FT                   domain-containing"
FT                   /note="domains: HAMP, PAS, HisKA, HATPase_c"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82871"
FT                   /protein_id="ADI82871.1"
FT                   /translation="MKSLLAIRTKIFLAILLILLVSYSFLVVITIRTVDSSLEAELSRK
FT                   LAEQVRYAKDQYTDRAEQIQYSLMHPASAPPVRERMVARDSLWLRDAARRWMMILPFVE
FT                   LIVFVDSRGTVITGGNQYRMDRTFELTPVVERALRERHPIVSTELVTTEFLCSEGLVNY
FT                   CRGGDAGNTGEVMMQTVVVPVVDTRGAMVGAFVAGDILETDTRLPSQVQEVFGRQVYVT
FT                   ITRKEIIPPDSFGKNGPQAIPARILGGLRQGLPFRGDAEIGGKVFTAAFDPLTNSRGDF
FT                   VGALVVALSRDDYKGVLQGSLGNIVASAILGLVLSFVTAYWVSLRLTKPVRELADGVRR
FT                   IEEGELQQRVAVTSSDEIGELAEAFNRMAAAIDERDRTIRTKAHDLENLNLKLTDMNEF
FT                   LERRVEERTAALQVEMGRLEAILTSMAEGIAVTDRDGRVILFNPAAQQLFEMVPHRVVG
FT                   QPILDICNQGEFCRLVEHITSMGENRDQATVREVDLDARGKKLKVTLAPLVDGDGHFAG
FT                   VVMSVRDVTAEEEVDRMKTEFISTVSHELKTPLTSIKGSLQLIVDKSRGFTDVEKELLG
FT                   VCLRNTERLIRLVNDILDIAKIESGKMEFALSPHSPAELVEWSVRELEGFAREHGVTVV
FT                   NEVSADLPAIYGDGDRLGQVLTNLIANAVKFSPRGAVVTISAEQSDNFVAVSVKDRGRE
FT                   IQWADRGKLFKRFQQIDSGDRRQHGGTGLGLAICKEIVERHHGRIFYSEGIGGGNVFTF
FT                   TVPIHEGEP"
     atgaaatcgt tgctcgcgat ccgcacaaaa atttttctcg ccatcctgct cattcttctc        60
     gtttcctatt cctttctcgt cgttattacc attagaaccg tcgattcttc cctcgaggcg       120
     gaactgtccc gcaaactggc cgaacaggtc cggtatgcca aggaccagta cacagaccgg       180
     gccgagcaga tccagtactc tctcatgcat ccggcctctg cgccgcccgt ccgcgaacgc       240
     atggtcgccc gcgacagcct ctggctgcgg gatgcagccc gccgctggat gatgatcctc       300
     cccttcgtgg agttgatcgt gtttgttgat tcccggggta cggtcatcac cggcgggaac       360
     cagtaccgca tggacagaac gtttgagttg acgccggtcg tggagcgtgc cctcagggag       420
     aggcatccta tcgtctcgac tgaactcgtg acgaccgagt tcctctgcag cgaagggctg       480
     gttaactact gtcgcggggg agacgccggg aacacgggcg aggtcatgat gcagacggtg       540
     gtggtgccgg tcgtggacac caggggggcc atggtcggtg ccttcgtggc cggagacatc       600
     ctcgaaaccg acaccaggct cccgtcgcag gttcaggaag ttttcggcag acaggtgtat       660
     gtgaccatca cccgcaagga gatcatcccc cccgacagtt tcggaaaaaa cggaccccag       720
     gcaattcctg cgcggattct ggggggcctc aggcaggggc tcccgttcag gggcgatgcg       780
     gagatcggcg gcaaggtctt cactgcggcc ttcgatcccc ttaccaatag caggggcgat       840
     tttgtcggag ccctggtcgt ggcgctttcc cgcgacgact acaagggggt tctgcagggg       900
     agcctgggca atatcgtggc gtcggcgatc ctgggcctcg tgttgtcctt tgtcaccgcc       960
     tactgggtat cgctcaggct gacgaaacct gttcgcgagc ttgcggacgg ggttcgacgc      1020
     attgaggaag gggaactgca gcagcgggtc gcggtcactt cctccgacga gatcggagag      1080
     ttggccgagg cattcaaccg gatggccgca gccattgacg agcgcgaccg aaccatccgg      1140
     accaaggccc acgacctgga gaacctcaat ctcaaactca cggacatgaa cgaattcctg      1200
     gagcgacggg tggaggagcg gaccgccgca ttgcaggtgg aaatgggacg gctcgaggcg      1260
     atccttacca gcatggcaga ggggatcgcg gtgaccgacc gggacgggcg cgtcatcctg      1320
     ttcaatccgg cggcccagca gcttttcgag atggtgcccc accgcgtggt cggtcagcct      1380
     attctggata tctgcaacca gggggagttc tgccggctcg tggagcacat cacctccatg      1440
     ggggaaaacc gtgaccaggc aacggtcagg gaagtcgatc tggacgcccg ggggaaaaag      1500
     ctcaaggtca ccctggcgcc cctggtcgat ggtgatgggc attttgccgg cgtggtcatg      1560
     tccgtccgcg acgtgaccgc cgaggaggag gtggaccgga tgaaaaccga gttcatttcc      1620
     accgtctccc atgaactcaa gacccccctc acctccatca agggttcgct ccagctgatc      1680
     gtggacaaga gcaggggctt caccgatgtg gaaaaagaac tgctcggcgt atgtctccgc      1740
     aataccgagc ggctcatccg actggtcaac gacatccttg atatcgccaa gatcgaatcg      1800
     ggcaaaatgg agtttgccct ttcgccccac tcgccggctg agctggtgga gtggtcggtg      1860
     cgggagctgg agggatttgc ccgggagcac ggcgtaacgg tcgtcaacga ggtgtcggcc      1920
     gatctgcccg ccatatacgg cgacggtgac cggctggggc aggttctgac caacctcatt      1980
     gcgaacgcgg tgaaattttc accacgggga gcagtggtaa ccatctctgc cgagcagagc      2040
     gacaactttg tcgccgtgtc ggtcaaggac cgcggacgcg agatccagtg ggccgaccgg      2100
     gggaaacttt tcaagaggtt tcagcagatt gacagcggcg accggcggca gcatggcggc      2160
     accggcctgg ggcttgccat ctgtaaggag atcgtcgaac ggcaccacgg caggattttc      2220
     tactctgaag gaatcggcgg aggcaacgtg ttcaccttca ccgttcccat ccacgaggga      2280
     gagccatga                                                              2289
//

If you have problems or comments...

PBIL Back to PBIL home page