(data stored in SCRATCH3701 zone)

EMBL: CP002031.PE91

CP002031.PE91        Location/Qualifiers
FT   CDS_pept        complement(99851..101155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="KN400_0092"
FT                   /product="amino acid aminotransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82955"
FT                   /protein_id="ADI82955.1"
FT                   /translation="MRNELVTPGAGELTYEIRNIVNVAEKLQKHGVKINWENIGDPIVK
FT                   KEEIPRWMKEIVAAAVMENDTWGYCHTRGVLETREFLCGLTNNRGGAQITPDDIIFFNG
FT                   LGDAISTVYGNLRHESRILMPSPTYTTHSIGEAAHAQAAPVCYRLKPEDNWFPDVEDLE
FT                   NHVKYNPQISGILLINPDNPTGMVYPREILEQIVAIARRYDLFIIADEVYNNITYNGQT
FT                   TVPISDVIGEVPAIAMKGISKEIPWPGSRCGWIEVYNGNRDEQFHKFLNSILTAKMNEV
FT                   CSTTLPQKCIPAIMKHPEYQTYLRERIACYERMSTITYDCLKQVPGLMVNRTNGAFYMS
FT                   VAFRDGLLTDRQSLPIESVEVRELVEKLVNAPGVSPDKRFVYYILASTGICIVPLSSFN
FT                   TPLQGFRVTLLEKDENECMRIYRTLAERIKEYLNS"
     gtgagaaatg aactggttac gccaggagcc ggcgaactga cctatgaaat ccgcaacatc        60
     gtgaatgtgg cggaaaagct ccagaagcac ggcgtcaaga tcaactggga gaatatcggc       120
     gatccgatcg tgaagaagga ggaaatcccc cgctggatga aggaaatcgt ggcagccgcc       180
     gtgatggaga acgatacctg gggctactgc catacccgtg gggtactgga aacccgggag       240
     tttctctgcg ggctgaccaa caaccgcggc ggggcccaga tcacccccga cgacatcatc       300
     ttcttcaacg gacttggcga tgccatctcc acggtttatg gcaatcttcg ccacgaaagc       360
     cgtattctga tgccatcccc cacctatacc acccactcca tcggggaagc cgcccacgcc       420
     caggcagcgc cggtctgcta caggctgaag cccgaagaca actggttccc cgacgtggaa       480
     gatctggaga accatgtaaa atataatccg cagatctccg gcatccttct cattaatccg       540
     gacaatccca ccggcatggt ctaccccagg gagatcctcg aacagatcgt agccatcgcc       600
     cgcaggtacg atctcttcat cattgccgac gaggtctaca acaacatcac gtacaacggc       660
     cagaccaccg tgcccatctc cgacgtgatc ggcgaggtgc cggccattgc catgaaggga       720
     atttcaaagg aaatcccctg gcccggctcg cgctgcggct ggatcgaggt ctataacggc       780
     aaccgcgacg agcagttcca caagttcctg aactccatcc tcaccgccaa gatgaacgaa       840
     gtctgctcca ccaccctgcc gcagaagtgc atcccggcca tcatgaagca tcccgagtac       900
     cagacgtacc ttcgggagcg aatcgcatgc tacgagcgga tgagcaccat cacctacgac       960
     tgcctcaagc aggttccggg tctcatggtt aaccggacca acggtgcctt ctacatgtcg      1020
     gtcgcgttcc gggacggact cctcaccgac cggcagtcgc tgcccatcga gagcgtggag      1080
     gtccgtgaac tggtggagaa gctcgtgaac gcccccgggg tttcgccgga caaacgtttc      1140
     gtctattata tcctggcaag cactggcatc tgcatcgtac ctctttcttc cttcaacacc      1200
     ccgcttcagg gcttccgggt tacgctgctt gaaaaggatg agaacgagtg catgcgcatt      1260
     taccgtaccc tggcggagag gatcaaggag tacttgaact cctga                      1305
//

If you have problems or comments...

PBIL Back to PBIL home page