(data stored in SCRATCH3701 zone)

EMBL: CP002031.PILT-2

CP002031.PILT-2      Location/Qualifiers
FT   CDS_pept        complement(206150..207220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT-2"
FT                   /locus_tag="KN400_0205"
FT                   /product="twitching motility pilus retraction protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83068"
FT                   /protein_id="ADI83068.1"
FT                   /translation="MDMNLLSQILGIAFEKRVSDLHFEVDNPPFFRAKGQLLRSKLPKL
FT                   SPQDTEFIARAVMEQNHRTLPDELRELDASYSLPNGGRFRVSIFRQRGSIGIVMRVIPP
FT                   HVGTFEELNLPPVLGEIAKAPNGLVLVTGPTGNGKSTTLASMIRHLNETCTFNIITIED
FT                   PIEFLFTSDKSCIIQREVGIDTVDFSAALRSSLRMDPDVIMVGEMRDLETIDACIKAAE
FT                   TGHLVFSTLHTQSAVSTINRLIGHFPPDAQEVLRQRLADILVATVSLRLIKDKSGENIL
FT                   PVVEVMRATTTIQACIREGRLDEIEKHIENGRSLYQMQTLDQHLLELCEKDVITFDQAK
FT                   QITRSMDLERKLAFTE"
     atggatatga accttctgtc ccagattctg ggcattgcct ttgaaaagcg ggtttccgac        60
     ctccacttcg aggtggacaa tccccccttc ttccgtgcca aggggcagtt gctccgctca       120
     aagttgccga agctctcccc ccaggacacc gaattcatcg cccgggccgt tatggagcag       180
     aaccaccgga ccctccccga cgagctgcgg gagctggacg cctcctactc gctccccaat       240
     ggcgggcgct tccgggtgag catcttccgt cagcgcggga gcatcggcat cgtcatgagg       300
     gtgattcctc cccacgtggg gaccttcgag gaactcaacc tgccgccggt cctgggagag       360
     atcgccaaag cccccaacgg cctcgtgctg gtcaccggcc ccacgggcaa cggtaagtcg       420
     accacccttg cctccatgat tcgccacctg aacgagacct gcaccttcaa catcatcacc       480
     atcgaggacc ccatcgagtt cctcttcacc tcggacaaga gctgcatcat ccagcgggag       540
     gtgggaatcg acacggtcga cttcagcgcg gcgctccgct cgtccctgcg gatggacccc       600
     gacgtgatca tggtgggcga gatgcgcgac ctggaaacca tcgacgcctg catcaaggcg       660
     gcggagacgg gccacctggt cttttccacc ctccacaccc agagcgccgt atccactatc       720
     aaccggctca tcggccactt cccccccgat gcccaggagg tcctgcgcca gcgcctggcc       780
     gacatcctgg tggccaccgt gtcgttacgg ctcatcaagg acaaatccgg ggagaacatc       840
     ctgccagtgg tagaggtgat gcgcgccaca accaccatcc aggcctgcat tcgcgaggga       900
     cgactggacg agatcgagaa gcacatcgaa aacggccgct ccctctacca gatgcagacc       960
     cttgaccagc acctgctgga gctgtgcgag aaggacgtca ttaccttcga ccaggccaag      1020
     cagatcaccc gttccatgga cctggagcgg aagctggcct tcaccgagta g               1071
//

If you have problems or comments...

PBIL Back to PBIL home page