(data stored in SCRATCH3701 zone)

EMBL: CP002031.PILT-3

CP002031.PILT-3      Location/Qualifiers
FT   CDS_pept        433541..434611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilT-3"
FT                   /locus_tag="KN400_0405"
FT                   /product="twitching motility pilus retraction protein"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83268"
FT                   /protein_id="ADI83268.1"
FT                   /translation="MARIDALFKLLKEQGASDLHLSSGAPPIFRLHGEMARQNFKVLSH
FT                   EELTAILYEILTDKQKADFEERRDLDFAYAIPGLARFRGNYMMTHRGIAAVFRIIPSKI
FT                   LSADDLSLPDGVRRMTQFKKGLVLVTGPTGSGKSTTLAAMIDLINATRKEHILTLEDPL
FT                   EFIHENKMSLLNQRQIGEHSLSFSAALRAALREDPDVILVGEMRDLETIGLAMSAAETG
FT                   HLVFGTLHTNSAAKTIDRIIDVFPTDQQEQTRAMLSESLKGVVCQQLLKTADGKGRVAA
FT                   LEIMLGTPAIANLIREGKTFQIPSIIQTAKRDGMQLMDQHLLDLFKTKRITAEEAYRCA
FT                   QDKKQFEQYLAEKPGQ"
     atggcacgta tcgacgcact gttcaagctg ctgaaggagc aaggggcctc cgacctccac        60
     ctgtcgtccg gggctccgcc cattttcagg cttcacggag agatggcgcg gcagaacttc       120
     aaggttcttt cccacgagga actgacggcc atcctctacg aaatcctgac cgacaagcag       180
     aaggccgatt tcgaggagcg gcgggacctg gacttcgcct atgccattcc cggcctggcc       240
     cggttccggg ggaactacat gatgacccac cggggcatcg ccgcggtctt ccggatcatc       300
     cccagcaaga tcctctcggc agacgacctg agccttcccg acggggttcg ccgcatgacc       360
     cagttcaaga aagggctcgt gctggtcacc gggcccacgg ggtcgggcaa gtccaccacc       420
     cttgccgcca tgatcgacct catcaacgcc acccgcaagg agcacatcct cactctggaa       480
     gatcctctcg aattcatcca cgagaacaag atgtcgctcc tgaaccagcg gcagatcggc       540
     gagcactccc tgagtttttc cgccgccctg cgcgccgccc tgcgggagga ccccgacgtg       600
     atcctcgtgg gcgagatgcg ggacctggag accataggcc tcgccatgag cgcagccgag       660
     accggccacc tggtcttcgg caccctccat accaactcgg cggccaagac catcgaccgg       720
     atcatcgacg tctttcccac cgatcagcag gagcagaccc gggccatgct ctccgaatct       780
     ctcaaagggg tcgtctgtca gcagcttctc aaaaccgccg acggcaaggg gcgggttgcg       840
     gcactggaga tcatgctcgg cacaccggcc atcgccaacc tgatccggga ggggaaaacc       900
     ttccagatcc cctccatcat ccagactgcc aagcgtgacg gcatgcagct catggaccag       960
     cacctgctgg acctcttcaa gaccaagcgg atcaccgccg aagaggccta ccgctgtgcc      1020
     caggacaaga agcagttcga gcagtacctg gcggagaagc cgggccagta g               1071
//

If you have problems or comments...

PBIL Back to PBIL home page