(data stored in SCRATCH3701 zone)

EMBL: CP002031.PPK-2

CP002031.PPK-2       Location/Qualifiers
FT   CDS_pept        754300..755778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppk-2"
FT                   /locus_tag="KN400_0708"
FT                   /product="polyphosphate-dependent AMP kinase"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0708"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83571"
FT                   /protein_id="ADI83571.1"
FT                   /translation="MFESAELDHAVDKKTWKARVPPLREALLDAQYDLLEARGFPVVIL
FT                   ISGVDGAGKGETVNILNEWLDPRHVETNAPGDASDEERERPPMWRFWRSLPPRGKIGIF
FT                   FGSWYSGAISDHMEGRSKQAKLDQALERIRRFERMLADEGALVLKFWLHLSRDQQERRL
FT                   KALEKNPRTRWRVTARDWKNFKVYERFRDLATHVLRATSTAEAPWTVVSGVDPRYRSLT
FT                   VGNAILSALRARLATPENPHPPRTALPVSPATDAVMLLRSLNLSRTITKKRYEEELEEL
FT                   QGRLSLLTREPRFRKRAVVAVFEGSDAAGKGGAIRRVTQALDAKIYRVVPIAAPTEDEL
FT                   AQPYLWRFWRTIPRLGRFAIFDRSWYGRVLVERVEGFCSRGDWMRAYSEINDFEEQLVE
FT                   SRIVVAKFWLAISPEEQLRRFREREETGFKRFKITEDDWRNREKWGEYETAVCDMIDRT
FT                   STEIAPWTLVEAENKQYARIKVLRTLCERIEAVL"
     atgttcgaat cggccgaact ggaccatgct gtggacaaga aaacctggaa ggcccgggtt        60
     cctcctctgc gggaggcact gctcgatgcc cagtacgatt tgctcgaagc ccgcggcttt       120
     ccggtcgtga tcctcatcag cggcgtggac ggtgccggca agggggagac ggtcaacatc       180
     ctcaacgagt ggctcgaccc gcgccatgtg gagaccaacg cgccggggga cgcctcggac       240
     gaggagcggg agcggccccc catgtggcgg ttctggcgct ccctcccgcc gagagggaag       300
     atcggtattt ttttcggatc ctggtacagc ggggcgatct cggaccacat ggagggtcgg       360
     agcaaacagg caaagctcga ccaggccctg gaacggatca ggcgcttcga gcggatgctg       420
     gcggacgagg gggctctggt cctcaagttc tggctccatc tgtcccggga ccagcaggag       480
     cggcgtctca aggcgctgga gaaaaacccc cggacccgct ggcgggtcac ggcccgggac       540
     tggaaaaact tcaaggtata cgagcggttc cgtgatctgg ccacccatgt cctgcgggca       600
     acgagcactg ccgaggcacc ctggaccgtt gtgtccggcg tcgatccccg ctatcgttcc       660
     ctgacggtgg ggaacgcgat tctctctgct ctgcgcgccc ggctcgccac ccccgaaaac       720
     ccccatccac cgcgcacggc gctccccgtg tccccggcaa cagacgcggt tatgctgctt       780
     cggtccctga atctttcccg aacgataacg aagaagcgct acgaagaaga actggaggaa       840
     ctccagggac ggctcagcct gctgacccgc gagccccggt tccgcaagcg ggcggtagtg       900
     gcggtgttcg aagggagcga cgcggccggc aagggtggcg ccattcgtcg ggtcactcag       960
     gccctcgacg ccaagattta ccgggtggtg cccattgccg cccctacaga ggacgagttg      1020
     gcccagccct acctgtggcg cttctggcgc actatcccgc gcctggggcg cttcgcgatc      1080
     tttgaccgtt cctggtacgg ccgggtgctc gtggagcggg tggagggatt ctgttcccgt      1140
     ggggattgga tgcgggccta cagcgagatc aacgatttcg aggagcaact ggtggagagc      1200
     aggatcgtgg tggccaagtt ctggctggcc atcagcccgg aggaacagtt gcggcgtttc      1260
     cgggagcgcg aggagaccgg tttcaagcgg ttcaagataa cggaggatga ctggcgtaac      1320
     cgggaaaagt ggggggagta cgagaccgcc gtctgcgaca tgatcgaccg aacgagcacg      1380
     gagatcgccc cctggaccct tgtggaagcc gagaacaagc agtatgcccg gatcaaggtg      1440
     ctgcggacgc tctgcgagcg gatcgaggca gttttatag                             1479
//

If you have problems or comments...

PBIL Back to PBIL home page