(data stored in SCRATCH3701 zone)

EMBL: CP002031.RADA

CP002031.RADA        Location/Qualifiers
FT   CDS_pept        complement(280904..282256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="KN400_0255"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83118"
FT                   /protein_id="ADI83118.1"
FT                   /translation="MKTVTRYACQKCGYQSAKWLGKCPDCAAWNSFVEEVTGGGRKGAA
FT                   SLPAATRPVPICDVASEAETRLSCGISEFDRVLGGGLVSGSLVLIGGDPGIGKSTILLQ
FT                   VMDHLARTAGPVLYVSGEESARQTKMRGERLGIGARELLVLAETSLELILSQVTALAPR
FT                   ALVIDSIQTVFSANLESAPGSVSQVRECAGRLMELAKRNGIPTLLVGHVTKDGSLAGPR
FT                   VLEHMVDTVLYFEGDPGHAFRILRAVKNRFGSTNEIGVFEMKEGGLSEVRNPSELFLAE
FT                   RPLGVSGSAVVTTIEGSRPLLVELQALVTPSSLGVPRRTTLGVDHNRLALLVAVLDKKV
FT                   GLHLSGQDIFLNAAGGARLSEPAIDLGMVAALASSHLDKIIDPHTVIVGEVGLAGEVRA
FT                   ITQAETRVREAAKLGFTRAVIPAGSVRQVGDVPGMNVVGVKSLDEALEQLF"
     gtgaaaaccg taacccgtta tgcctgccag aaatgcggct accaatcggc caaatggctt        60
     gggaaatgcc ccgactgcgc cgcctggaac agttttgtcg aggaagtcac cggcggcgga       120
     cgaaagggtg ccgcctccct gcccgcagcc acccgcccgg tccccatctg tgatgtggcc       180
     agcgaggcgg aaacacgcct gtcgtgcggc atctccgaat tcgaccgggt actgggcggt       240
     ggtctcgtct ccggctccct ggtgctcatc ggcggcgacc ccggcatcgg caaatccacc       300
     attcttttgc aagtcatgga ccaccttgcg cggaccgcgg gaccggttct ctacgtatcg       360
     ggagaggaat cggcgcgaca aacaaaaatg cgcggcgaac gcctgggcat cggagcacgt       420
     gaactgctcg tcctcgccga gacctccctc gaactcatcc tgtcccaagt taccgctctc       480
     gccccccggg cccttgtgat cgactccatc cagaccgttt tcagcgcgaa cctcgaatcg       540
     gcgcccggca gcgtcagcca ggtgcgcgag tgcgccggca ggctcatgga gctggccaag       600
     cgcaacggca tccccaccct ccttgtggga cacgtgacca aggacggctc cctggcgggc       660
     ccacgggtgc tggagcacat ggtcgacacg gtgctctact tcgaagggga cccggggcat       720
     gccttcagga ttctcagggc cgtcaagaac cgcttcggct caaccaatga aatcggtgta       780
     ttcgagatga aagagggcgg cctcagcgaa gtgagaaacc cctcggagct cttcctggcc       840
     gaacggccgc tcggcgtttc ggggtccgcc gtcgtcacca ccatcgaggg gagccgaccg       900
     ctgctggtgg aactgcaggc actggtcacc ccctcatccc tgggcgttcc acgccgcacc       960
     actctcgggg ttgaccataa ccgcctcgcg ctcctggtag ccgtgctcga caaaaaagtc      1020
     ggcctccacc tgtcggggca ggacatcttc ctgaacgccg ccggcggcgc acggctcagc      1080
     gagccggcca tcgacctggg catggtggcg gccctcgcat caagccactt ggacaaaata      1140
     atcgatcccc acacagtcat tgtcggcgag gtgggccttg cgggggaagt ccgcgccatt      1200
     acccaggcgg agacacgggt ccgcgaggcc gccaagctgg gcttcacacg ggcggttatc      1260
     cccgccggca gcgtccgaca ggtcggcgat gttcccggca tgaacgttgt gggagtgaaa      1320
     tccctggatg aagcgctgga acagctcttc tga                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page