(data stored in SCRATCH3701 zone)

EMBL: CP002031.RARD

CP002031.RARD        Location/Qualifiers
FT   CDS_pept        complement(801076..801987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rarD"
FT                   /locus_tag="KN400_0748"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0748"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83611"
FT                   /protein_id="ADI83611.2"
FT                   /translation="MTNPPDHEAREARTGVIFGLAAYLLWGFFPIYFKALAGVTPLEVL
FT                   SHRIAWSVATLAVMLTVARRWDGVRAAFSQPRTLMTLCATTLLIAVNWLVFIYAVGAGK
FT                   VLQSSLGYFINPLVSAFLGVVFLHERLSPKQKASFILAAAGVAILTLRHGEFPWIALSL
FT                   GLSFGLYGLLRKKAPVDSLAGLTVETLLLFPLALCYLGWLAYQGKSAFVSGPTHITVLL
FT                   ACAGVLTSTPLIWFAAATKRLRLATVGLMQYVVPTLHFVLAVFAFGETFTPTHLASFAL
FT                   IWTGLVLYTYDAAKLIFGNGGR"
     atgaccaatc cgccggacca cgaggcgcgg gaggcccgca ccggtgtgat cttcggcctc        60
     gccgcctacc tcctctgggg gttctttccc atctacttca aagccttggc cggcgtgacc       120
     ccgctggagg tcctgtccca ccggatcgcc tggtcggtgg cgacgctggc cgtgatgctg       180
     accgtggccc gccggtggga cggggtccgg gccgccttca gccagccccg caccctgatg       240
     accctctgcg ccaccacact cctgatcgcc gtcaactggc tggtcttcat ctatgccgtg       300
     ggcgcgggca aggtgctcca gtcgagcctc ggctacttca tcaaccccct ggtgtcggcc       360
     ttcctggggg tggtcttcct gcacgagcgg ctcagcccca agcagaaagc gagcttcatc       420
     ctggccgccg ccggggtggc gatcctcacg ctccggcacg gcgagttccc ctggatcgcc       480
     ctgtccctgg gactttcctt cggcctctac ggcctgctgc gcaaaaaagc gcccgtggac       540
     tccctggccg gtctcaccgt ggagaccctg ctcctgttcc cgctcgccct ctgctacctc       600
     ggctggctgg cgtaccaggg aaagagcgcc ttcgtctccg ggcccaccca catcaccgtc       660
     ctgctcgcct gcgccggggt cctcacctcc acccccctga tctggttcgc ggcggccacc       720
     aagcggctgc gcctcgccac ggtggggctg atgcaatacg tggtgcccac gcttcacttc       780
     gtgctggcgg tcttcgcctt cggcgagacg ttcaccccca cccacctggc aagcttcgcc       840
     ctgatctgga cggggctcgt cctctacacc tacgacgcgg caaaactcat cttcggcaac       900
     ggggggcgct ga                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page