(data stored in SCRATCH3701 zone)

EMBL: CP002031.RECF

CP002031.RECF        Location/Qualifiers
FT   CDS_pept        2793..3890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="KN400_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82866"
FT                   /protein_id="ADI82866.2"
FT                   /translation="MHLNAIAISAFRNIDHVEISFDRRFNVLHGANGQGKTSVLEAIYL
FT                   LGTMKSFRMAKAHDLIAWNAPHSLVRGDIDKAGVRREIALYLGREGRKARIDRKPVTKL
FT                   ADFFGAVNAVVFSPEEIGMARGGPELRRRYLDRAIFNGDLGYLLLHHEYHRLLKQRNAL
FT                   LRRGERDGLEVWTIQLAEAGARLMVKRRAYLSQIEPLVRQFYRDIAGAGQEVGLAYRCH
FT                   GLASAEGERDCAAALRELMAAHEAEELRRGATGVGPHRDDVDFILNGRVIRHHGSQGEQ
FT                   RSFVLAVKMAEIEYLERLNGAPPVLLLDDISSELDPERNANLMTFLRGKRMQVFITTTD
FT                   VSTLRLEGIDTHASFRVSRGTVTPV"
     atgcacctga acgcaattgc catcagcgcc ttccgcaata tcgatcatgt ggaaatctca        60
     ttcgatcggc ggttcaacgt cctgcacggc gccaatggac agggaaaaac gtcggtgttg       120
     gaggccattt acctcctggg gaccatgaaa tcgttccgga tggccaaggc ccatgatctc       180
     atcgcctgga acgcccccca ctcactggta cgtggcgata tcgacaaggc gggggtcaga       240
     cgtgagatag ccctctatct cggccgcgag ggccgtaagg cccgcattga ccggaaaccg       300
     gtcaccaagc ttgcggattt tttcggcgcc gtgaacgccg tggtattttc tccagaggag       360
     ataggcatgg cccgcggagg gccagaactc agacgccgct acctggaccg ggccatcttc       420
     aacggcgact tggggtacct gctcctccac catgagtacc atcggctgct caagcagcgt       480
     aatgctctgc tgaggcgggg cgaacgggat ggattggagg tctggacaat ccagctggcc       540
     gaggccggcg cccggctcat ggtaaagcga agggcctacc tttctcagat agagccgctg       600
     gtacggcagt tttaccggga tattgccggt gcgggccagg aggtgggact tgcctatcgc       660
     tgccacggac tggcatccgc cgagggcgaa cgcgattgtg cagcggccct ccgggagctc       720
     atggcagccc atgaggccga ggaactgcgc cggggggcca ctggcgtagg cccccaccgg       780
     gatgacgtgg atttcatcct gaacggtcgg gtcatccgcc accacggctc ccaaggggag       840
     cagcggagct ttgtcctggc cgtaaaaatg gccgagatcg agtacctgga gcggctcaac       900
     ggtgcgccgc cggtgcttct gctggacgac atctcatcgg aactggatcc cgagcgcaac       960
     gcgaacctga tgacctttct ccggggaaaa cggatgcagg tcttcataac caccaccgat      1020
     gtatcaaccc tccgtctgga ggggatcgac acccacgcgt cgtttcgcgt ttcacgtgga      1080
     acggtgacgc ctgtatag                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page