(data stored in SCRATCH3701 zone)

EMBL: CP002031.RECR

CP002031.RECR        Location/Qualifiers
FT   CDS_pept        77276..77869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="KN400_0072"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82935"
FT                   /protein_id="ADI82935.1"
FT                   /translation="MVHFSDSLSRLLAELQKLPGVGEKTALRLAFHLLKSPDNAAALAD
FT                   SLRDVMSRVRFCSVCFGITEDDPCRFCSDARDDGAICVVEEPQDLLAVERTRAFRGRYH
FT                   VLQGALSPLNGVTPDRLRVAELMKRLEGGGVREVVIATNFTVEGEATALYLARMIKPLG
FT                   VRVTRLAHGIPLGSDLEFVDAATVQRALEGRSEL"
     atggtacatt tttcagactc attgtcacgg ttgctcgcgg aactgcaaaa gctgccggga        60
     gttggcgaga aaaccgccct gcgcctcgcc tttcatcttt tgaaatcccc cgacaacgcc       120
     gctgccctgg ctgacagtct tcgggacgtc atgtcccggg tgcggttctg ttccgtctgt       180
     ttcggcatta ccgaggacga tccctgccgg ttttgctccg atgcccgaga tgacggtgcc       240
     atctgcgtcg tcgaggaacc ccaggacctt ctggccgttg agcggacccg agccttcagg       300
     gggcgttatc atgtgctcca gggggcgctg tccccgctca acggtgttac ccccgaccgg       360
     ctccgcgttg cggagctcat gaagcggctg gaggggggag gggttcggga agtggttatt       420
     gccaccaact tcaccgtgga gggcgaagca accgcgctct atctggccag gatgatcaag       480
     cccctggggg tcagggtgac acgactcgcc cacgggatac cgctcggcag cgatctggag       540
     ttcgtggatg cggccacggt gcagcgggcg ctggaaggac ggagcgagct gtaa             594
//

If you have problems or comments...

PBIL Back to PBIL home page