(data stored in SCRATCH3701 zone)

EMBL: CP002031.RPLI

CP002031.RPLI        Location/Qualifiers
FT   CDS_pept        681960..682406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="KN400_0644"
FT                   /product="ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83507"
FT                   /protein_id="ADI83507.1"
FT                   /translation="MKVILKENVENLGHIGDIVKVAPGYARNYLIPRNFAIEATEKNAK
FT                   ALEHAKRQLEYKRNKVLEQARLLVAKIEGLSLSISHQAGEEGKLFGSVTNMELAELLKA
FT                   QGVEIDRKKIVLAEPIKHVGEFTAVVKVHPEVAANLKVVVTKAE"
     atgaaagtca ttctgaagga aaacgtagaa aatctcggcc acattggcga tattgtcaag        60
     gttgcacccg gctatgcccg caactatctg atcccccgca atttcgccat cgaagcaacc       120
     gaaaagaacg ccaaagccct tgagcacgcc aagcgtcagc tggagtacaa gcgcaacaag       180
     gtccttgagc aggcccggct gcttgtcgcc aagatcgaag ggctgagcct gagcatttcg       240
     caccaggcag gggaagaagg caagctcttc ggttcggtca ccaacatgga gctcgctgag       300
     ttgctcaagg cccagggcgt cgaaatcgac cggaagaaga tcgtgctcgc cgagccgatc       360
     aagcatgtgg gcgagtttac cgccgtggta aaggttcacc cggaggttgc cgccaacctg       420
     aaagtcgtgg tgaccaaggc ggaataa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page