(data stored in SCRATCH3701 zone)

EMBL: CP002031.RPLS

CP002031.RPLS        Location/Qualifiers
FT   CDS_pept        659183..659539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="KN400_0624"
FT                   /product="ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83487"
FT                   /protein_id="ADI83487.1"
FT                   /translation="MNKIDAIELEQMKKNIPPFKPGDTLKVHVKIVEGDKSRIQAFQGV
FT                   CISRQNGGIRESFTVRKISNNIGVERVFPLHSPTVDAIEVITRGHVRRAKLYYLRKLRG
FT                   KAARIREKKYVAAQ"
     atgaacaaga ttgatgcaat cgaactggag caaatgaaaa agaacatccc ccccttcaag        60
     ccgggcgata ctctcaaggt tcacgtgaaa atcgtggaag gcgacaagag ccgtatccag       120
     gcgttccaag gggtgtgcat cagccgacaa aacggcggca tccgtgagtc gttcaccgtc       180
     cgcaagattt ccaacaacat cggggtcgag cgtgtgttcc cgcttcactc gcccaccgtt       240
     gacgctattg aagtgattac ccgcggtcat gtccgccggg caaagctcta ctatctccgc       300
     aagctgcgcg gcaaggccgc ccgcatccgc gaaaagaagt acgtggcggc tcagtaa          357
//

If you have problems or comments...

PBIL Back to PBIL home page