(data stored in SCRATCH3701 zone)

EMBL: CP002031.RPSP

CP002031.RPSP        Location/Qualifiers
FT   CDS_pept        656705..656971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="KN400_0619"
FT                   /product="ribosomal protein S16"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83482"
FT                   /protein_id="ADI83482.1"
FT                   /translation="MAIKIRLARAGAKKKPFYQIIVADVRSRRDGRFIENVGTYDPNQN
FT                   PAAVKFEEAKTLEWLGKGAQPTDTVKQILKKAGIWEKFVAKSV"
     atggccatca agattcgtct ggctcgtgcc ggggccaaga agaagccctt ttaccagatt        60
     atcgtcgccg acgtgcgtag tcggagagac ggtcgattca tcgagaacgt ggggacctat       120
     gaccccaatc agaaccccgc cgccgtcaag ttcgaggaag ccaaaaccct cgagtggctt       180
     ggcaagggag ctcagccgac cgatacggtc aagcagattc tcaaaaaagc aggtatctgg       240
     gagaaattcg tcgcaaagtc tgtgtaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page