(data stored in SCRATCH3701 zone)

EMBL: CP002031.TSSE

CP002031.TSSE        Location/Qualifiers
FT   CDS_pept        424925..425332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tssE"
FT                   /locus_tag="KN400_0399"
FT                   /product="type VI secretion system needle hub protein TssE"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83262"
FT                   /protein_id="ADI83262.1"
FT                   /translation="MREERLLERIRSLERDPSRRGGTDRGRLVDSILAHVRRIINTRRG
FT                   SVPIAPDFGIPDMLDVLQSYPDSVREIERSIRAAIQGFEPRLADVRVAFVPQEDDVLAL
FT                   RFAISARLGSDGGAVCFETLVDTDGKVTVRR"
     atgcgcgaag aacgccttct ggaacgtatc cgctccctgg agcgggatcc gtcgcgccgc        60
     ggggggactg atcggggccg tctggtggat tcaatcctgg cacacgtccg ccggattatt       120
     aacacgcgcc gggggagcgt gcctatcgcc cctgacttcg gcatccctga catgctcgac       180
     gtgcttcaga gctacccaga ttcggtgcgg gagatcgaac ggagcatccg tgccgccatc       240
     cagggctttg agccgcgtct cgccgacgta agggttgcct tcgtcccgca ggaggacgac       300
     gtgctggcgc tccggtttgc catctccgcc cggcttggca gcgacggcgg agcggtctgt       360
     tttgaaacgc tggtggatac cgacgggaag gttacggtga gacgttga                    408
//

If you have problems or comments...

PBIL Back to PBIL home page