(data stored in SCRATCH3701 zone)

EMBL: CP002031.TSSG

CP002031.TSSG        Location/Qualifiers
FT   CDS_pept        427058..428050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tssG"
FT                   /locus_tag="KN400_0401"
FT                   /product="type VI secretion system protein TssG"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83264"
FT                   /protein_id="ADI83264.1"
FT                   /translation="MGSPPWSPPASLETQLFERGHEFSFAQAVRLLRLLAAAQGREGAC
FT                   PCGVRVRPELSLSFPVADVARIERQSDGYRITARFLGLYGPSSPLPTFYTEELIDEERE
FT                   DGSASRDFLDVLSHRIFDLWVAGDAKYRLFNRVVEDGSGDDLERLFCLAGLDLAQGQTV
FT                   LPESGRWLRYVGLLGQVPRSALGLRTMVADALGVPVEVIPCQHRQVSIPPGQRLAVGIA
FT                   ASSLGIDTVVGTNLDDRLGMFRLCLGPLSREQFADLLPGAPGRSTLDLIVELYLDAPLA
FT                   WDVELTLAPGETPEARLGACRGARVGWDTWLGVAAGESLPCVVFPGHFP"
     atgggctccc cgccttggtc accgccagct tctctagaga cgcagctgtt cgagcggggg        60
     catgagttct cctttgccca ggcggtgcgc ctgctgcggc ttcttgcggc cgctcagggg       120
     agggagggcg cttgcccgtg cggggtacgg gtccggcccg agctttccct ctcctttccg       180
     gttgctgatg tggcgcggat cgagcggcag agcgacggct accggataac ggcccgcttc       240
     ctcggtctct acggcccgtc atctcccctg ccaaccttct acaccgaaga actgatagac       300
     gaggagcggg aagacggctc tgcttcacgg gattttctcg acgtgctgag ccaccggatc       360
     tttgatctct gggtcgccgg cgacgccaag tatcgcctgt tcaaccgggt tgtggaggac       420
     ggaagcgggg atgacctcga acgtcttttt tgtttggctg ggctcgacct ggcccagggg       480
     cagacagtcc tgccggagtc cggccgctgg ctccgctatg tgggtctcct gggacaggtt       540
     ccccgctctg ccctggggtt gcggaccatg gtcgccgacg ccctcggcgt accggttgaa       600
     gtcatcccct gccagcaccg gcaggtgtcg attccccccg gacagcggct agccgtgggc       660
     atagccgcga gcagtctcgg catcgacacg gtcgtcggaa ccaatctgga tgaccggctg       720
     ggcatgttcc gcctgtgcct ggggcccctt tcccgcgaac agttcgcgga tctcctcccc       780
     ggcgcccctg gccgctcgac tctggacctg atcgtggaac tctacctgga tgcccccctc       840
     gcctgggacg tggagttgac cctggccccg ggagagacgc cggaagcacg tctcggcgct       900
     tgtcgggggg cacgggtcgg atgggacacc tggcttggtg tcgcagccgg cgaatccctg       960
     ccttgcgttg tatttcccgg acattttccc taa                                    993
//

If you have problems or comments...

PBIL Back to PBIL home page