(data stored in SCRATCH3701 zone)

EMBL: CP002031.USP-3

CP002031.USP-3       Location/Qualifiers
FT   CDS_pept        complement(234563..235030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="usp-3"
FT                   /locus_tag="KN400_0232"
FT                   /product="universal stress protein Usp"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83095"
FT                   /protein_id="ADI83095.2"
FT                   /translation="MRILLAVDGSPGSDAAVAEVCRRPWPAASEVRIVTVLSPLESLPL
FT                   RNSSHIPLSYDEIFEQQGWDAAKRLKDAAETLQQRAPDLHVTPVLLEGRPKNAILDEAE
FT                   RWCADLIVVGSQGSGALKRFFLGSVSLAVALHAPCSVEIIRRSPDQPDPAA"
     atgagaattc ttcttgcagt agatggttca ccgggcagcg acgctgccgt tgcagaggta        60
     tgccgcaggc cctggccggc cgcaagcgaa gtccgcatcg tgaccgtgct ttccccgctg       120
     gaatcgctcc ccttgcgcaa ctcttcacac atccccctgt cctatgacga gatcttcgag       180
     caacaggggt gggatgcggc caaacgcttg aaggacgcgg ccgaaaccct gcagcaacgg       240
     gcacccgacc tgcacgtcac gcccgtgctg ctggaaggcc ggcccaagaa tgccattctg       300
     gacgaagccg aacgatggtg tgcggacctg atcgttgtcg gctcccaagg atccggggcg       360
     ctcaagcgct ttttcctcgg ctccgtatcc ctggccgttg cccttcacgc gccctgctcc       420
     gtggagatca tacgccgctc gcccgatcag ccggacccag cggcctga                    468
//

If you have problems or comments...

PBIL Back to PBIL home page