(data stored in SCRATCH3701 zone)

EMBL: CP002031.YHCC-1

CP002031.YHCC-1      Location/Qualifiers
FT   CDS_pept        364579..365496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhcC-1"
FT                   /locus_tag="KN400_0335"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase, TIGR01212 family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83198"
FT                   /protein_id="ADI83198.1"
FT                   /translation="MTERRYNAFSDELRRVFGCRVQRVSVDAGFTCPNRDGTTGLGGCI
FT                   FCGGRGSGSFGIRPELGVADQLAHGMTYLSRRYGAEKFLAYFQSYSNTYAPVERLRLLY
FT                   DEALSVPGVAGLIVGTRPDCLPPEVIDLLAEYARSTYFWLELGMQTSHDRTLALLNRGH
FT                   DAASFQDAADRCRRRGIRLCAHVILGLPGETDADMLETAMMLNGVGIDGVKLHHLHVMK
FT                   DTPLEVMYRQGAVGCLGRDDYVGLVCDFLERLDPRIVVHRLVGDAPADHLVAPAWTLEK
FT                   SAVLAAIDEEFIRRDSRQGARLSR"
     gtgacggagc ggcgctacaa cgctttttcc gatgagcttc gccgcgtctt cggctgccgg        60
     gtacagcggg tgtcggtgga tgcgggcttc acctgcccca accgggacgg caccacgggg       120
     ctcggcggct gcattttctg cggcggccgg ggctcgggct ccttcggcat caggccggaa       180
     ctgggagtgg ccgatcagct cgcccacggc atgacgtacc tctcgcggcg ctacggggcg       240
     gagaaattcc tcgcctattt ccagtcctac tccaacacct acgccccggt agagcggctc       300
     cgactcctct acgacgaggc cctgtcagtc cccggcgtgg ccgggctcat cgtcggcacc       360
     cgtcccgact gtctcccgcc tgaggtcatc gatcttctgg ccgagtatgc ccgctcgacc       420
     tacttctggc tcgaactggg aatgcagaca tcccacgacc ggacgctggc cctcctcaac       480
     cgtggccacg acgcggcatc gttccaggat gccgcggacc gttgccgccg ccggggaatc       540
     aggctctgcg cgcacgtgat tctcgggttg ccgggagaga ccgacgcgga catgctcgaa       600
     acggcgatga tgctcaacgg ggtcggtatc gacggggtga agctccacca tctccacgtg       660
     atgaaggata cgccgctgga agtcatgtac cgtcaggggg cggtcggctg tctggggcgg       720
     gatgactacg tgggactcgt ctgcgatttt ctggagcggc tcgatccccg cattgtcgtc       780
     catcgcctgg tgggggatgc cccggccgac cacctggtgg cccctgcctg gaccctggag       840
     aagtcggcgg ttcttgccgc aatcgacgag gaattcatcc gtcgcgactc ccgccagggg       900
     gcccgcctgt cccggtaa                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page