(data stored in SCRATCH3701 zone)

EMBL: CP002031.YHCC-2

CP002031.YHCC-2      Location/Qualifiers
FT   CDS_pept        complement(598684..599643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhcC-2"
FT                   /locus_tag="KN400_0564"
FT                   /product="radical SAM domain iron-sulfur cluster-binding
FT                   oxidoreductase, TIGR01212 family"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADI83427"
FT                   /protein_id="ADI83427.1"
FT                   /translation="MSDLFIHPELRFHSYGTWLRRRFGCNVSKVNVDGGFTCPNRDGSR
FT                   GTGGCIYCDNASFSPGGTVPDKSIELQMAEGMAYHRQRLGSEKFIIYFQKFTNTYAPAA
FT                   RLRDLYTRALSHPDVVGISVGTRPDALADEALELLADLAQEHYVCIELGLQSMDDAILE
FT                   RINRGHTLDEYLRTVDRIAGRGIALCTHLIYGFPGETREGFLKTAHLLAGLPVDSVKLH
FT                   QLHAVKGTRLAELYHRREFVPITLAEYVTTACDFLELLPPRIAVQRLYGSAPLAIRVAP
FT                   TWNLKNNQMWYAIVNELRRRGTWQGCRLDREHCRVGNL"
     atgtcagacc tgttcataca tcccgagctt cgcttccact cctacggcac ctggctgcgc        60
     cgccgcttcg gctgcaacgt gagcaaggtg aacgtggacg gcggcttcac ctgccccaat       120
     cgcgacggca gccgcggcac cggcggctgc atctactgcg acaacgcctc cttttccccc       180
     ggcggcaccg tccccgacaa gtcgatcgaa ctgcagatgg ccgagggcat ggcctaccac       240
     cggcaacggc tgggaagcga gaagttcatc atctacttcc agaagttcac caacacctac       300
     gcgccggctg cccgtttgcg ggacctgtat acccgcgccc tgtcccatcc cgacgtggtg       360
     gggatttcgg tgggcaccag gcccgacgcc ctggcggacg aggcccttga gctactggcc       420
     gatctggcgc aggagcacta cgtctgcatt gaactggggc ttcagtccat ggacgacgcc       480
     atcctggagc ggatcaaccg gggccacacc ctggacgagt acctccgaac cgtggatcgg       540
     atcgcgggac gcggcatcgc cctctgcacc catctcattt acggctttcc cggcgaaacc       600
     cgcgaaggat tcctgaaaac cgcgcacctg ctggcaggac tcccggtgga ctcggtgaag       660
     ctccaccagc tccatgcggt aaagggaacc cgtctggccg aactctacca tcggcgcgaa       720
     ttcgtgccga taacccttgc tgagtacgtg accacggcct gcgacttcct ggagcttctt       780
     cccccccgca ttgccgtcca gcgactctac ggctcggccc ccctcgccat ccgggtggcg       840
     cccacctgga acctgaagaa caaccagatg tggtacgcaa tcgtgaacga gctgcgtcgg       900
     cgcggcacct ggcaggggtg caggctcgac cgggagcact gccgcgtcgg caacctgtag       960
//

If you have problems or comments...

PBIL Back to PBIL home page