(data stored in SCRATCH3701 zone)

EMBL: CP002031.YRDA

CP002031.YRDA        Location/Qualifiers
FT   CDS_pept        complement(31544..32083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrdA"
FT                   /locus_tag="KN400_0021"
FT                   /product="protein of unknown function YrdA, isoleucine
FT                   patch superfamily of carbonic
FT                   anhydrases/acetyltransferases"
FT                   /db_xref="EnsemblGenomes-Gn:KN400_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ADI82884"
FT                   /protein_id="ADI82884.1"
FT                   /translation="MIRPFKGMSPQIDPSAFIADTAVVIGDVTIGPESSIWYNVVARGD
FT                   VNFIRIGARSNIQDLSMLHVTHKKHADDPGAPLVIGDDVTVGHSVTLHGCTIGNGAFIG
FT                   MQAMVMDKAVVGEGALVGARALVTEGTVIPPHTLWVGAPAKYKRDLTPDEIAWLKRSAG
FT                   NYVRYSREYLEEDADR"
     atgattcgcc ccttcaaggg aatgagcccg caaatcgatc cgtccgcgtt cattgccgac        60
     accgccgttg tcatcggcga cgtgaccatc ggccccgaaa gcagtatctg gtacaacgtg       120
     gttgcccgag gcgatgtcaa tttcatccgc atcggcgccc ggagcaacat ccaggatctc       180
     tccatgctcc atgtgaccca taaaaagcac gccgacgacc cgggagcccc ccttgtcatc       240
     ggcgatgacg tgaccgtcgg ccacagcgtg accctccacg gctgcaccat cggcaatggt       300
     gccttcatcg gcatgcaggc aatggtcatg gacaaggcgg tggtgggcga aggagcactc       360
     gtaggcgcac gggcactggt gaccgaggga accgtcatcc cgccccatac cctctgggtt       420
     ggggcaccgg caaagtacaa gcgcgacctg acccccgacg aaattgcctg gctgaagcgc       480
     tcggcaggca actacgtgcg ctactcacgg gaatatcttg aggaagacgc ggaccgctga       540
//

If you have problems or comments...

PBIL Back to PBIL home page