(data stored in ACNUC7421 zone)

EMBL: CP002047.GND1

CP002047.GND1        Location/Qualifiers
FT   CDS_pept        415944..416978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnd1"
FT                   /locus_tag="SBI_00352"
FT                   /product="6-phosphogluconate dehydrogenase-like protein"
FT                   /note="COG1023 Predicted 6-phosphogluconate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00352"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03473"
FT                   /db_xref="GOA:D7BYE5"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYE5"
FT                   /protein_id="ADI03473.1"
FT                   /translation="MATDTPMQLGMIGLGRMGANLVRRLMRDGHRCVVYDLDESAVREL
FT                   EGEGAVAARSLGDLVAKLERPRAAWLMLPAAVVQPTLDQLAELLDPDDAVIDGGNSYYR
FT                   DDITRAAQLAPRRIHYLDCGTSGGVWGLDRGYCLMIGGEREPVARLDPIFRTIAPGTGS
FT                   AEPTPSRQADGTAPQGYLHCGPSGAGHFVKMVHNGVEYGMMASIAEGLSIIEHADAGLR
FT                   KRTADAETTPLREPEAYQYEIDVGEVAEVWRRGSVVGSWLVDLTADALARSPHLEDFAG
FT                   HVSDSGEGRWTVRAAIDEGVPTPVIATALTDRFESRGLGEFGDRVLSAMRSEFGGHAEK
FT                   RSRP"
     atggcaaccg acacccccat gcagctcggc atgatcgggc tcggccggat gggcgcgaac        60
     ctcgtgcgcc ggctgatgcg cgacggccac cgctgtgtgg tctacgacct cgacgaaagc       120
     gccgtacgag agctggaagg cgagggcgcc gtcgccgccc gctcgctcgg cgacctggtg       180
     gcgaagctgg agcggccacg ggccgcctgg ctcatgctgc ccgccgccgt cgtccagccc       240
     accctcgatc agctggccga actcctcgac ccggacgacg cggtcatcga cggtggcaac       300
     tcctactacc gcgatgacat cacccgtgcg gcgcagctcg ctcctcgccg catccactat       360
     ctggactgcg ggacctcggg cggggtctgg gggctcgacc gcggatactg cctcatgatc       420
     ggcggtgagc gggagccggt cgcccggctc gaccccatct tccggaccat cgcgcccggc       480
     accggctccg ccgagccgac cccgagcaga caggccgacg gcacggcacc ccagggctat       540
     ctccactgcg gtccgagcgg cgccggacac ttcgtgaaga tggttcacaa cggggtcgag       600
     tacggaatga tggcctcgat cgccgaagga ctcagcatca tcgagcatgc ggacgccggg       660
     ctgcgcaagc gcacggccga cgcggagacc accccgctgc gcgaaccgga ggcctatcag       720
     tacgagatcg atgtcggcga ggtcgccgaa gtgtggcgcc gcggctcggt cgtgggctcc       780
     tggctcgtcg acctcaccgc cgacgccctc gcccggtccc cgcatctgga ggatttcgcc       840
     gggcacgtct cggactccgg cgaaggccgt tggaccgtac gggcggcgat cgacgaaggc       900
     gtacccaccc ctgtgatcgc caccgcgctc accgatcggt tcgagtcccg cggtctgggc       960
     gagttcggcg accgggtcct gtccgccatg cgcagtgagt tcggcggaca cgccgagaag      1020
     cggagccggc cgtga                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page