(data stored in ACNUC7421 zone)

EMBL: CP002047.ILVB1

CP002047.ILVB1       Location/Qualifiers
FT   CDS_pept        464817..466481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB1"
FT                   /locus_tag="SBI_00397"
FT                   /product="putative acetolactate synthase, large subunit"
FT                   /note="COG0028 Thiamine pyrophosphate-requiring enzymes
FT                   [acetolactate synthase, pyruvate dehydrogenase
FT                   (cytochrome), glyoxylate carboligase, phosphonopyruvate
FT                   decarboxylase]"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00397"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03518"
FT                   /db_xref="GOA:D7BYJ0"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D7BYJ0"
FT                   /protein_id="ADI03518.1"
FT                   /translation="MVNVEPPERPLSAGHLIVAQLEREGVRRIYGVPGESFLDVLDGLH
FT                   DSPMSTVVTRHEGGAGFMALAEGRLTGRPGVAIVTRGPGAANAFIAVHTAYQDATPMVL
FT                   FVGLIPVPDRGREAFQEFDLSGWFGSTAKKVVMLDDPTAAARVVSEAVHAARSGRPGPV
FT                   VIGLPEDILTRPAAPSRTVQPLAVARPRAAEAELKELVGRFERARRPLVVVGGEGWTTQ
FT                   SGRELIRWATERSVPVLADFRAYDAVPHDLDGSGAYAGSLGYGRSDHAAQLLDDADLTV
FT                   FLGAPRGDVLSDGYTRGLDSETVLVLPGDAPGHCGRIDQFITAHAPSFVLDLVTAPAAL
FT                   RADVAWFRAARAAHARFRTPAPATDSVADDAFVDLTAVMGVLRQELAPDAVITYGAGNH
FT                   ALWPARYLPHQAPASLIAPRNGAMGMGIPAAVAASLAFPGREVVSVAGDGCFLMNGQEL
FT                   ATAVGHGAVFVALVVDNGCYATIREHQEDAYPDRPSGTQLTNPDFAAWARSYGAYGETV
FT                   AATRDFRDAFRRARASGLPAVLHLIQDPAVRAPATVG"
     atggtgaacg tcgaaccccc cgagcgcccc ctctccgcgg gccatctgat cgttgcgcag        60
     ctcgaacgcg aaggcgtccg acggatatac ggcgttcccg gagagtcctt cctcgacgtt       120
     ctcgacggcc tgcacgattc gccgatgtcg accgtggtga cccggcacga gggcggtgcg       180
     ggctttatgg cgctggcgga gggccggttg acggggcggc ccggggtggc gatcgtgacc       240
     cggggcccgg gcgccgcgaa cgccttcatc gccgtgcaca ccgcatacca ggacgcgaca       300
     ccgatggtcc tcttcgtcgg gctgattccg gtgcccgacc gcggccggga ggcgttccag       360
     gagttcgacc tcagcggatg gttcggcagt acggcgaaga aggtcgtcat gctggacgac       420
     cccaccgccg ctgcccgcgt cgtctccgag gccgtccacg cggcccgcag cggtcgcccc       480
     ggccccgtgg tgatcggcct gcccgaggac atactcaccc gcccggcggc cccctcccgc       540
     accgttcagc cgctcgcggt ggcccggccg cgtgccgcag aagcggagct gaaggagctg       600
     gtgggccggt tcgagcgggc gcggcggccc ctcgtcgtgg tcggcggcga gggatggacc       660
     acacagagcg gccgcgaact catccgctgg gcgacggagc ggtcggtccc cgtcctcgcc       720
     gacttccgcg cctacgacgc ggtcccccac gacctcgacg gctccggcgc ctacgccggc       780
     tcgctcggat acgggcggag cgaccacgcg gcccagttgc tcgacgacgc ggacctcacg       840
     gtcttcctcg gcgctccgcg cggcgatgtg ctcagcgacg gatacacccg tggcctggac       900
     tcggagaccg tgctcgtcct ccccggtgac gcacccggcc actgcggccg catcgaccag       960
     ttcatcacgg cccacgcgcc gtccttcgtc ctcgacctcg tcaccgcgcc cgcggcactg      1020
     cgggccgacg tggcgtggtt ccgggccgcc agggcggccc acgcccgctt ccgcaccccg      1080
     gcccccgcca ccgattcggt tgcggacgac gcctttgtgg atctgaccgc ggtcatgggg      1140
     gtgctgcggc aggagctcgc gcccgacgcc gtcatcacct acggcgccgg caaccacgcc      1200
     ctctggccgg cccgttacct accgcaccag gccccggcct ccctcatcgc accgcgcaac      1260
     ggcgcgatgg gcatgggcat accggccgcc gtggcggctt ccctggcctt ccccgggcgc      1320
     gaggtcgtgt ccgtcgccgg cgatggatgc tttctgatga acggtcagga gttggccacg      1380
     gcagtgggac acggagccgt ctttgtcgct ctggtggtcg acaacggctg ctacgccacg      1440
     atccgggagc accaggagga cgcctacccg gaccgccctt cgggcaccca gctgaccaac      1500
     ccggacttcg cggcgtgggc gcgctcgtac ggcgcgtacg gcgagaccgt ggccgccacc      1560
     cgcgacttcc gcgacgcgtt ccgccgtgcc cgcgcgagcg ggctcccggc cgtgctccac      1620
     ctcatccagg atcccgcggt ccgcgctcct gccaccgtcg gctga                      1665
//

If you have problems or comments...

PBIL Back to PBIL home page