(data stored in ACNUC7421 zone)

EMBL: CP002047.PE1

CP002047.PE1         Location/Qualifiers
FT   CDS_pept        691..801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SBI_00001"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SBI_00001"
FT                   /db_xref="EnsemblGenomes-Tr:ADI03122"
FT                   /db_xref="UniProtKB/TrEMBL:D7BSU5"
FT                   /protein_id="ADI03122.1"
FT                   /translation="MEATLGDRSCLPWKLVEMITTELTPAPDGWALGGRA"
     atggaggcga ccctcggcga tcggtcctgt ctgccctgga agctcgtcga gatgatcacc        60
     accgaactga cccccgcacc ggacggctgg gccctgggcg gccgcgcgtg a                111
//

If you have problems or comments...

PBIL Back to PBIL home page